SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000149 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000149
Domain Number 1 Region: 685-798
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-39
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 1150-1262
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-36
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 3 Region: 914-1027
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-36
Family Spermadhesin, CUB domain 0.00015
Further Details:      
 
Domain Number 4 Region: 568-679
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.09e-35
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 5 Region: 1379-1492
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.3e-34
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 6 Region: 2210-2317
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-34
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 7 Region: 1033-1144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-34
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 8 Region: 3378-3490
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-34
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 9 Region: 3141-3263
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-33
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 10 Region: 2675-2787
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-33
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 11 Region: 1845-1951
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-32
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 12 Region: 1502-1606
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-32
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 13 Region: 2435-2552
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-32
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 14 Region: 3023-3135
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-32
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 15 Region: 807-906
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-32
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 16 Region: 1725-1836
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-31
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 17 Region: 1614-1721
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-31
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 18 Region: 1270-1377
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-30
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 19 Region: 1974-2077
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-30
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 20 Region: 450-563
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-29
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 21 Region: 3494-3606
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-29
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 22 Region: 2908-3022
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-28
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 23 Region: 2319-2430
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-28
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 
Domain Number 24 Region: 2079-2195
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-26
Family Spermadhesin, CUB domain 0.00077
Further Details:      
 
Domain Number 25 Region: 3262-3376
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-22
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 26 Region: 2557-2672
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-22
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 27 Region: 104-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000135
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 28 Region: 407-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000189
Family EGF-type module 0.013
Further Details:      
 
Domain Number 29 Region: 2791-2906
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000122
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 30 Region: 151-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000292
Family EGF-type module 0.016
Further Details:      
 
Domain Number 31 Region: 231-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000346
Family EGF-type module 0.014
Further Details:      
 
Domain Number 32 Region: 371-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000118
Family EGF-type module 0.026
Further Details:      
 
Domain Number 33 Region: 274-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000186
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000000149
Domain Number - Region: 183-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0529
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000149   Gene: ENSGACG00000000111   Transcript: ENSGACT00000000149
Sequence length 3607
Comment pep:known_by_projection scaffold:BROADS1:scaffold_95:388665:426113:-1 gene:ENSGACG00000000111 transcript:ENSGACT00000000149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGKWCFDPPRPRMLSDDGHLVFTTGDGKEIRFETSASGRVKVDNEDLTQLLGQIKTNKED
INDIKANGGGVSPEVTNKLKQLESEVSTLQNTVTTLESTVQRLSCTSDPCHNGGTCLNLL
NSYYCLCPGNWAGLNCATDVNECQLYSGTFQSCQNGATCVNSPGSFSCTCSPEWSGSLCT
VRYDDCRNAGQDLCAHGTCIDADRLTAGQPKYQCICESGWEAPAGNPSCVSDVNECNLPN
KPCSTNPAAPCYNTQGSFYCGACPAGWQGNGYSCQDVDECLTNNGGCSSTPVVQCLNTMG
SFHCGPCPPGYEGDGRACTQTNMCNNNNGGCYPLATCSFSPGTSLPVCTCPPGYIGSGYG
PTGCSQTSNACQTNSPCVHGQCVATTSAPGYICICSSGWGGTQCDHDIDECLSDPCQNGA
TCTDGIDGFTCTCTAQWTGPLCQSAQQAVCGGSLSGPAGSFSYPNTPGHDEYEHQVSCAW
VIRIDPNKILRVTFPFFDLESSSNCNYDFLQIHDGDSVSAHMLGKYCGPNNPQELHSSHN
ALYFWFRSDHSSSAGGFTVAWQSQDPVCGGELTASYGSINSPGYPGNYPPGRDCYWTVAV
QPGRLLTFAFGTLSLEQHPDCNFDFLEIRDGLLPGDTVLGKYCSTALPPPMQTTGPAAWI
HFHSDFSVSDRGFHLTYTTSPSDPGCGGTFTDSEGIIISPNWPNNYAHNRQCIYLIRLPV
GETLALNFTHMNLESHSSCTFDYVEVRDGRVETDPLMGKYCGSSLPAPLLSSSNSLWIRF
RSDSSVSLAGFRAVYSVVCGGVLSGAGQLGSPYHPDPYPHNKVCEWVINQPEGSVVTLRF
LSFHVEGGSCTFDFVEVRDGSTSNSPLLGTFCGAEVPPRLQSTQRSMYIRFKTDSSVSNR
GFEAAYDSALEAPGCGDVLTSPSGTITSPGHPGSYPHGANCTWYISVAPGNLVRLSFDSF
HLEYHMNCNFDYLEVYDNGTVQTGSKVGRYCGRSVPPSITSTGSLLTLLLVSDWSLATEG
FSASYVSLNATTDCGETFTSSTGSFSSPNYPDYYPSTRDCVFKITVQVNMQIMLNFSHFE
LEGSPPSCNFDFVEIRDGGYETSPLIGKFCAAQGPPVLVSHSNRLWVRFHSDSSVAFGGF
TAHWDGTQTGCGGTLSTPSGGFSSPSYPLPYHPNAECYWTIRTNPGSQLLLSFSHFHLES
SSACAFDYLSVYDGNSTGGPQLAQLCGSQLPSSISSSSNQLYIKLRTDGSVSAGGFLASY
TSKCRVLVLNQHKGVVESLNFPNNYPHHSECSWTIQASAGNTVNYTFTAFQLEATSSSCP
FDRITLFDGPNEQAPLIGTFCGYTPPPANHTTSSALTVVFTSDSAVSSSGFQMMWHQNGC
GGELSGSTGSFSSPDYPNRYPENKECLWYVTTAAGSSITLTVHEFDVEFHPDCSYDVLEV
FGGPDLLAPQLAELCSTTSSPMRVSSTGNRLTVRFKSDAYVSGRGFNASWAEVQGGCGGP
VTAPSGEIHSPWYPSSYPNNVDCSWIISVDPNHRVFFNFSDVDIEHHSNCSRIHDGPTTS
SPLLAQVCGSSLPPSITSTQNTIYVRFRSDLSHNHRGFSARFSQACGATIIADDSGGAIV
SPRYPASYPPDQNCSWILRAQEPFNHVTLSFTDFELEMINWNCSHDAVDVLDGDNYQAPS
IGRYCGFEIPQPVTSFSNSMVVNFISDHSVSSKGFRATFSASTSSCGGDLVMESAAFNSP
NYPDAYPPDVECVWTISSSPGNRLQLSFILFNLQGDAGCHNDYVEIREGSSTGALVGRFC
GSSLPSNYTSVIGHILWVKFVSDPSISAAGFRATFSHLYGNDVEGESGQIASPLYPRTYP
NNAHYHWTITVDRGSYIQIRFVDMDIEDLYDCNYDQLKIFDGPDVHHIPIGAFCGLALPP
PLRSWGSTVTLQFTTDSVVGGRGFLVEWTAVQDSGPPPTITPAGACGGVLMTGDTPGFLF
SPGWPDSYAPHLECTWLIRSPDSTIELNLLSLDIEDYPGCYFDSLVIRDGGSSLSPLMAT
VCGPDPPAALHSTGDSMFIHFSSDASIAGRGFNASYSKGCGGLLHVDRGVLSSPQYPHNY
LPGLNCSWHVMVTTGFRASVTFQSPFQIQGYGTQCSSGDYLELRNGPDGSAPLLGGRLCG
SSVPSLFQTTDNHLFIHFASDSTNEATGFKLTFEAHSQACGGYIELDGNDPPGYITSPNY
PQNYPQNIDCIWVITVPNGEAVQIDFEEEFYIEPTNSCLYDYLELRDGSTINTGFISRLC
GNTRPSTQHSTGASMLLRFRTDASVVHKGFKAKYSIATCGGTYIGQRGTIHSPGFPEANY
PDSSSCEWYLEGPTGHYLTLSYGNLSLQTTQGCSADYVEIREYNASGRLLGRHCGSHPPA
SVDTSDSFAYVRFVSDNSGNAAGFSLTFEASIEVCGGELNAPSGTISSPNYPNLYPHNRV
CRWELVVSPGRRVTLTMEDLRLEESAASCAFDYVEVFSRSSTGCWSMPLCLHIFCGTVPA
GTEVRSSGNTMTVVFHTDASVSNGGFMASYSSEEPAECGGILNNPAGGNFTSPGYLVSNY
SNNLNCEWLIQNPQHVNSSIVVLIEELHLENQQTCESDYLQLRLGDSDGELLAKFCGQTT
PRIPIVVFTHELWVHFKTDASPGRCGLQGKYMFSECGGLQTGEGGLVSSPNYPNTYPSPS
RCAWLLEAPIGHTITLTFSYFNLEPHSQCGWDSVTVFNGGSPGSPVIGQYCGGTSPGTKQ
SGSNKLAVVFLADHSVSTGGFMASWSADSSGCGGVIHADMGTIKSPNNPQEFSQPMCSVP
GGSIAHQGSHLEMRFNSDFQIPNSTGRARAATSRVWSGQTQDAEALLSTGCGSVAPGTIV
APYNILTSRFQGTGAPGRGFSASFSTRCGANFTAPSGRVVSPNYPANYPDHSNCNYTIDA
GEQSVVVLTFQVFQVEGNFLAHSTCQYDGLKIYSMATGGRALATLCGSSVPGPFSSFGPM
LLHFYSDSVISDRGFTAEYRAIPCGGFFNSTMGTVSSPALSMTNYHHNINCTYHIVVRAN
TVVDIKFNTFHLEASSSCRYDYVAVYDGQDILAPLLGKFCGSVLPPDLRSSTNQLFIVFK
TDASGNGIGWRAVYTETLGPAQGCGGYLSMPMGMFGSPDPDLDGRYEPRMDCRWTIELPV
NRAVNLTFNSFEVESSSTCVYDYVRVFDGDNENFPLVGTFCGNFVPAHFVSSGNFLTIRF
VTDSSVQRRGFNATYSAVPLVCGGTLNATTTIQSLVSPSFPNGYSPYTSCRWVLDAPAQE
SIKVSVQTFVLQPSQSCSTNYLEMKDWPVGDDGQSHKFCASDGPPPDFYSYSRTVLVHFK
SDTFMTGNGLMLSYQIASCSRTYEQEYGYLKSPGWPDIYPHNMDCTVILKAPHNSSISFF
FNYFDVESHSHCGFDYLEIRDGGEADSPLIGRFCGNTLPSPIFTPSNLLYLRFKSDFSAA
RDGFDATWTSSPHGCGGTLYGDHGSFSSPNYPATYPNSSHCEWGIEAPRGRVVTITFAQI
SIDDTGDCQDNFLKLYDGPDATSPPAGPFCGVESDIAPFTASTHQAYVVFRAQYASQPSG
FRLSWSS
Download sequence
Identical sequences G3N4C9
69293.ENSGACP00000000149 ENSGACP00000000149 ENSGACP00000000149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]