SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000161 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000161
Domain Number 1 Region: 42-271
Classification Level Classification E-value
Superfamily DNase I-like 1.58e-30
Family DNase I-like 0.0013
Further Details:      
 
Domain Number 2 Region: 494-803
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.9e-21
Family RNA-dependent RNA-polymerase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000161   Gene: ENSGACG00000000122   Transcript: ENSGACT00000000161
Sequence length 1328
Comment pep:known_by_projection scaffold:BROADS1:scaffold_58:895150:901849:-1 gene:ENSGACG00000000122 transcript:ENSGACT00000000161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKQQNNASTKLEVCLCFTLFVCICILYILLCLFFISIIMSHINISTLNINGARDATKRSL
LYQLMKVKGIDVLFLQETHSDKSNETDWKREWGGDIVLSHNTTTSGGVGVLFSKTFMPQS
MEVKHVVEGRLLVVKGTFEHITCVFVNVYAPVSGPDRVVFLHALSTVLGSVSEEAFLFLG
GDFNSTENDLLDRNHIEPHALKQLIAEHEVVDVWRCLNGNERQYTWAHSRGSIISLARLD
RFYCFRHHFNIYKVCRMVPVGFTDHALVLCKVFINNCKAKSAYWHFNTALLEDTLFKDVF
KFFWSGFKNRKHDFTSLKQWWDYGKVEIKQLCQQYTLNVTRDITGSMRNLETEIVELQNI
AESTGNRDHIKDLKLKKSALADLLGTKAQGALVRSRFMSATLMDAPSRFFFGLEKRNGQS
RVMHTLRSATGQELKDPKDIRKRAVTFYSELYRSEYREEDGLFDCFCTELPKVPEDVNAA
LEGPLLATELYVALQSMEGGKAPGIDGIPVEFYREFWSVMGEDLLTVFHESFKDRNLPLS
CRRAVLTLLPKKGDLQEIKNWRPVSLLCADYKILSKALANRLREVMDLVIHQDQTYCVPG
RNILDNVSLIRDILDISNSLGIKAGLISLDQEKAFDRVEHHYLWRTLESFGLSPGLMAMI
KVLYRDIESVLKINGSLSGPFKVCRGVRQGCSISGMLYALAIEPMLCKIRANIEGLVLKG
FLKNLILSAYADDIVVFIKNQEEVGRLGTIVKDFGKLSAARVNWAKSEALAVGTWKGDLP
SLPGGLTWKTDGFKYLGVYMGSNDTVQKNWEGMEEKIKGRLEKWKWLKPHMSYRVRTLVI
NNLVASALWHRLACMEPPKGLLQRVQAILVDFFGDKMHWVPQRVRFLEKGEGGQGLVHIP
SRVATFRFQFTQRYLTGPTQVVWRDLTTFILRKAAGLGIDTALFLMDFNLVKLRGLSPFY
QSLFRAWHFFSWERLGPVCSLHWLLEEPLVNGARLDVQDGTTPGLNSMLCSSGTTTLRKV
VAVAGPEMTNAPAVACLLGLKSIRQSRRILNRWADQLTGEERKMLQEYSRGEETPREDDP
FPDLGFVPMLQGGSGPLLDGAKEKLDLHTAKGKAIYARCVKALNWRKLNGRADTVWRKEL
GISTGSKVGWKVLYKPPIKKRTGDLQWRILHGAIAVNAFISVINPGVARHCLFCGEVETV
FHSFYYCKRLYSLFNALQNVFNHFEERWSQNTFIVGVSYNKKHATKWKLLNFVVGAAKLA
IYCSRKNRVEGRAGQEALPAFVSLVKARVWVDFRFFKSMNNVDEFIGKWCFKEAICCVSG
DDLIFRPP
Download sequence
Identical sequences G3N4E1
ENSGACP00000000161 ENSGACP00000000161 69293.ENSGACP00000000161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]