SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000166 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000166
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000334
Family C1 set domains (antibody constant domain-like) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000166   Gene: ENSGACG00000000125   Transcript: ENSGACT00000000166
Sequence length 149
Comment pep:known_by_projection scaffold:BROADS1:scaffold_58:839899:841410:1 gene:ENSGACG00000000125 transcript:ENSGACT00000000166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHPSPLPLAVPGQSFTVQCEASGFAPLALELSWEFKGTDGKSRPLGSGSLTGHRQAWDGT
YSQSTRLELDSAELDLGRGGEVTCVAVHLGGTRRASVTLNVIGFSSPSIEDSMAMVGVAL
VLYGLIKFVSWTVTSSGSDEAGQREKKDK
Download sequence
Identical sequences G3N4E6
ENSGACP00000000166 ENSGACP00000000166 69293.ENSGACP00000000166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]