SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000265 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000265
Domain Number 1 Region: 109-368
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.92e-92
Family Eukaryotic proteases 0.00000459
Further Details:      
 
Domain Number 2 Region: 1-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000126
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 3 Region: 37-72
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 80-120
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000028
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000265   Gene: ENSGACG00000000207   Transcript: ENSGACT00000000265
Sequence length 369
Comment pep:known_by_projection scaffold:BROADS1:scaffold_1092:763:3988:1 gene:ENSGACG00000000207 transcript:ENSGACT00000000265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CEASQMKCRNGRCKPKFWECDGFDDCGDGSDEENCGKCKAGEFLCRNGRCVPQKSKCNGK
DDCSDGSDESRCEKCKPLVLQQCSEFTFRCRNGRCISKLNPECDGELDCEDGSDEKDCTC
GMRPYQSSRIVGGEASREGEWPWQVSLHVAGTGHVCGGSVLSNRWLLTAAHCVQDNGPNK
YSQADQWEALLGLHMQSQTNEWTVRRKVRRIIAHPDYNSFTYDNDLAVMELDASVTLNQN
IWPICLPSATYDFPAGQEAWITGWGATREGGLAASVLQKAEVRIINSTVCKSLMDDQVTD
RMLCAGVLKGGVDACQGDSGGPLSVTAPGGRVYLAGVVSWGDGCGRRNRPGVYTRITEYR
GWITEQTGV
Download sequence
Identical sequences G3N4P5
ENSGACP00000000265 ENSGACP00000000265 69293.ENSGACP00000000265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]