SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000469 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000469
Domain Number 1 Region: 354-601
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.85e-68
Family Eukaryotic proteases 0.0013
Further Details:      
 
Domain Number 2 Region: 133-222
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000902
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0087
Further Details:      
 
Domain Number 3 Region: 49-99
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000324
Family Ovomucoid domain III-like 0.013
Further Details:      
 
Domain Number 4 Region: 264-299
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 5 Region: 231-262
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000469   Gene: ENSGACG00000000362   Transcript: ENSGACT00000000469
Sequence length 610
Comment pep:known_by_projection scaffold:BROADS1:scaffold_131:152872:159287:-1 gene:ENSGACG00000000362 transcript:ENSGACT00000000469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRLYLILIILITTNQTAPSTSPEAPEEDEFLGPRECLIKKLTRGSCDLVFCPPWERCIEG
HCSCKPPYLCPSEGARPVCGLDHRTYRSYCQLMVHVCLHPSVPTEDQPKFNSTILSDTAA
VKIFLPDARSPGGGEELLVCQRLWNIAAANVACKAGGTPLGALAADSTSYGSLTTAGGNT
ESPKRCVSLRCQGYEASLAECVIYDKVDIGNQEVATATCYQAPEAANASECGFTCANTKC
VSANRTCDGVDDCGDGSDEMCCKKCRGGGFRCKTGACVHREALGDEQIDCLDGEDEATKH
AAIGHPSAFSDRTMFTFSTEPTKLLPTNSETRAGRAHLESRLYCGIPNATTVDNVEVEGR
ANRGRVKRVVGGVPANPTQIQWQVAVVENKKVDCGGAYIGGCWVITAAHCVRPNPSAFMV
KFSLWRKIQAQSTTDIVPVQEILIHPKYGANYENDIALLKLKKLPFEEKCLKDNPAISAV
CVPWSTQLFQPNHTCSISGWGRTAEGKGAKVLLWANVSLIADCQRFYNDRFRPGMMCAGA
VEGGVDSCQGDSGGPLVCEDELGVSYLWGIVSWGRKCAEPGFPGVYTQVAHYFEWIRYHT
GWPAVTKFNS
Download sequence
Identical sequences G3N599
69293.ENSGACP00000000469 ENSGACP00000000469 ENSGACP00000000469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]