SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000533 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000533
Domain Number 1 Region: 3233-3344
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-30
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 3338-3449
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-30
Family Cadherin 0.00047
Further Details:      
 
Domain Number 3 Region: 3821-4018
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.65e-29
Family Laminin G-like module 0.0092
Further Details:      
 
Domain Number 4 Region: 1020-1139
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-27
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 1548-1656
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-27
Family Cadherin 0.00061
Further Details:      
 
Domain Number 6 Region: 451-570
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 3127-3231
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-26
Family Cadherin 0.00078
Further Details:      
 
Domain Number 8 Region: 2274-2380
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-26
Family Cadherin 0.00085
Further Details:      
 
Domain Number 9 Region: 1127-1259
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-26
Family Cadherin 0.0015
Further Details:      
 
Domain Number 10 Region: 915-1029
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 11 Region: 1448-1552
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 12 Region: 2805-2918
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-25
Family Cadherin 0.00068
Further Details:      
 
Domain Number 13 Region: 3025-3133
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-24
Family Cadherin 0.00084
Further Details:      
 
Domain Number 14 Region: 139-260
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-23
Family Cadherin 0.001
Further Details:      
 
Domain Number 15 Region: 1757-1877
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-22
Family Cadherin 0.00082
Further Details:      
 
Domain Number 16 Region: 815-919
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 17 Region: 709-821
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-22
Family Cadherin 0.0014
Further Details:      
 
Domain Number 18 Region: 2066-2173
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 19 Region: 2587-2692
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-21
Family Cadherin 0.0027
Further Details:      
 
Domain Number 20 Region: 2919-3023
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 21 Region: 1661-1763
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-20
Family Cadherin 0.0017
Further Details:      
 
Domain Number 22 Region: 3437-3552
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-20
Family Cadherin 0.0019
Further Details:      
 
Domain Number 23 Region: 2174-2281
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-19
Family Cadherin 0.0011
Further Details:      
 
Domain Number 24 Region: 2478-2585
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-18
Family Cadherin 0.0021
Further Details:      
 
Domain Number 25 Region: 1236-1346
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-18
Family Cadherin 0.0032
Further Details:      
 
Domain Number 26 Region: 2381-2481
Classification Level Classification E-value
Superfamily Cadherin-like 2e-18
Family Cadherin 0.0025
Further Details:      
 
Domain Number 27 Region: 1355-1454
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-18
Family Cadherin 0.0039
Further Details:      
 
Domain Number 28 Region: 1865-1988
Classification Level Classification E-value
Superfamily Cadherin-like 2e-16
Family Cadherin 0.0021
Further Details:      
 
Domain Number 29 Region: 1975-2078
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000842
Family Cadherin 0.0035
Further Details:      
 
Domain Number 30 Region: 562-661
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000228
Family Cadherin 0.0036
Further Details:      
 
Domain Number 31 Region: 2698-2812
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000642
Family Cadherin 0.0053
Further Details:      
 
Domain Number 32 Region: 4098-4141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000136
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 33 Region: 35-151
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000108
Family Cadherin 0.0046
Further Details:      
 
Domain Number 34 Region: 3550-3641
Classification Level Classification E-value
Superfamily Cadherin-like 0.000003
Family Cadherin 0.01
Further Details:      
 
Domain Number 35 Region: 396-463
Classification Level Classification E-value
Superfamily Cadherin-like 0.000003
Family Cadherin 0.015
Further Details:      
 
Domain Number 36 Region: 4136-4176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000345
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 37 Region: 252-352
Classification Level Classification E-value
Superfamily Cadherin-like 0.00005
Family Cadherin 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000533   Gene: ENSGACG00000000415   Transcript: ENSGACT00000000533
Sequence length 4519
Comment pep:known_by_projection scaffold:BROADS1:scaffold_119:101294:203249:1 gene:ENSGACG00000000415 transcript:ENSGACT00000000533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGHHESKKLIYLTFTVNSSTGQGQKRLLLVPGLSFTLTVYRATLYENSAARTYANTKVKM
GIYLAQRSWEIRYRITSGDDEGFFKVEEYVLGDFCFLRIRTKGGNAAILNREIQDNYVLT
VKASVKGDTLLETWTKVSIQVLDMNDLRPLFSPTTYSVNIAESTPLRTSIAQVTATDADI
GSNGEFYYFFKEKIELFAVHPTSGVVSLSGKLNIDEQNQYDLEILAVDRGMKLYGNNGVS
STAKLLVHVERVNEHAPVMNVVAHSPSGLDKNPVYAMVTVDDFDEGLNGEVDSVVIVGGD
PSEQFFIERLTKGEFAVKASESFNRDTYPYGCNLTLQAKDRGAPQKFSPVKVVHIMVKKK
QTAEAVFERELYDLSLNEISPPGTIVEAVKISAEPDNVAYMMTPSADSAFFQINTLTGVI
STTQWFTQVSQNVFNLELVEIDSDVKVKVRVTIEDANDNPPTFDQASYEVLINESVLVGT
NVLTVSAVDEDKGENGYITYSISSFQPLPFKINQFSGIISITKELDFESSPESFVFLVRA
SDWGSPYRRESEVNVTIHLENVNDNQPLFEMIACHGVISRDLAVNEVITTMSAIDIDELE
LVKYKILSGNERGYFDLNPDSGVLSLQNSFVTASPMNGVFSLKITATDGENFAEPMFVNI
SVAQGKSPTSFNCRETRVAQKLAEKLLKKSKASTKHKIEEGFIDLFSVNRQTPQFDKAFP
TDISVWEDLKIGSSVFKVNAFDGDTGFNGQILYSISDGNTDNCFTIDMETGLISVFLPMD
REKRDRYLLNLTIYDLGLPQKTAWRLLTVYIEDANDNAPQFLEEGGYSIVIPENTAIGTD
VIQVEATDKDLGPNGEVVYSVLTGTSQFGINYTSGIVYVAGQLDREFVSTFNLKIEARDK
GVKGGQKFSVITMKVILEDVNDCPPLFIPNVYKARALEDLPVGTVVAWLETQDPDLGLGG
QVRYSLANDYNGWFEVDRASGAIRLTKELDYETQQFYNLTVKAKDKGRPVSLLSVTFVEV
EVVDVNENLYAPYFSHFALTGLVKENARIGTTLLQVTANDDDTGRDGDIQYSIHDGSGLG
RFAIDGETGVIYTTDMLDRETKDSYWLTVYASDHGVVPQFATIEVFIQVEDVNDNAPLTS
EPLYRPSVPENSPRDLSVIQIEAQDPDAVPPSASDRLNYRITSGNPQNFFTINTRSGLIT
TTSRKLDREQQTEHVLEVLVLDGGPTPRQSTVWVMVQILDENDNKPTFPEKVYQVKLPER
ERRKKGEPIYRVFAYDRDEGPNSDLSYSIVDGNEEGKFFIDPKTAVVSSRKAFTAGSYDI
LTIKATDNGRPQKSSTARLHIEWIRRSPPSTVPVLFDEPFYNFTIMENDKVAEIVGLVSL
QQSSAPLWFDITGGNSDSIFAIEKAVGTIVIAKLLDAEQRSFYNLTVQATDGTNTAYTQV
HITVMDNNDNAPIFSQPTYDVTISEDTPPDTEVVQVLATDRDEHHWLTYSLQSSIDSSSM
RLFRIHPTVGTIYTAQRLDHEACAQHILTVIVKDQEFPYRKNLARVLIEVEDINDHVPIF
TSALYEGSVYESAAVGSAVVQVTALDKDKGVNAELHYSIEAGNTGNTFHIEPILGIVTVA
RDLDLSSLGYYVLTIRVTDNGSPPLSTTTTVRIAVTLSDNAGPKFPQPEYQAEITEMAVM
GTSITTVSAASQSTLTYDIKQGNTDQVFQLNQYSGVISTQKLLDYETTESYILIVQATNM
AGMASNVTLIIQVVDENDNPPVFQQLHYHGSISEAAPVNSLVLNSDDSPLVIKATDADRN
QNALLVYQIVEETAKTFFTVDLGTGSIRTIANLDHETFAIFHFHVHVRDNGKSQLTAESP
TEVTIQVLDTNDSPPRFTQNAYETVLLLPTYVGVEALQVSAMDPDEDVPTGLTYSLTDGV
LQYFAIKPSNGVITVKDNNFSKERFRFSVKVSDGKFSSTALVTIIVRKALDSGLSFTNSL
YTSSIQENVSNITKVAVVNAVGNRLNEPLKYTLLNAGTGFKISPTSGVIQTTGIPFDREE
HEFYELVVEARREHDRFHVARVMVTVHVEDINDNAPVFVGLPYYAAVQVDAQPKSSIFRV
MAVDCDKGINGEVSYYLKDDHGHFEINQQTGGLSLKKAFESDLSNMEYQMEIYARDGGYP
PISSTIEFPITVVNKAMPVFDKPFYSVSVNEDVAVHTPILGINATSPEGQNIIYTIVDGD
PSLQFDIGFDTGVISVIHSLDYEAAASYHLTIRATDYLTGARAEVDVDVVIQDVNDNQPI
FQKMSYRVVLSETVMIGTPALQVIATDKDSEKNNVVRYQIFSDEHNSTDYFHIDSSSGLI
LSARMLDHELVQKYDFIVRATDNGFPPMSSEVSVIIVVNDMNDNPPVFNQLLYEAYVNEL
APRGHFVTCVQASDADSSDFEKLEYSILSGNERINFLMDNNTGILTVSGHRKQRMDLVYS
LNVSVSDGVFTSTAQVHIKVLGANLYSPVFGQNMYEAELKENAAVGTKVIQVKATDADPW
LDHIIYSFVNDVGKDQFSIDENGQITTAEKLDREDPANKDIVLAVAAQDPGGRVSYCTVQ
VTLLDDNDNVPCFRATEYRASVKSDVSKGFLVTQIQAHDPDDGTNAKVTYSLYSEAHVPV
VDILEIDPDNGWMVTKGSFSHLRNSVLSFFVKAVDGGHPVRHSLVSVYIHVLSPDAFIPS
FSQHQYFFSMPEDTPIGSAIGTVRLNISSGYTFLPATFALVNGETVENNQNAVFVVERDT
GVIMADKLLDYEMVKEYHLKVTATVQQAKVDYVTSIYVEVKVLDLNDNKPAFETNSYEAT
VMEGMSIGTRIIQVQALDQDSGAYGQVTYHLGTFIQSTGDLDTVVDTFSIDSNTGWISTR
KDLDHETNPSYTFLVVASDLGETLSLSGTTTVTIAVSDINDNPPMFLEQSYFGSVQESDP
PGEVVAVLNTRDDDSSAVNRQVSYHITGGNYRGVFALGLVQGEWKMYVKRPLDREDRNLY
IINVTASDGLFVSQATVEVTVIDTNDNRPICDQAVYTASVSENLPVNSLLLRIGATDADI
GVSAWIQYSLHGPGSQDFSIDPDTGEVKSSIILDHEMTPCYRLIAQATDGGGRWCRAEVQ
LAVTDMNDNPPIFTLSQYTASVYEDTATKALLTRIQAIDPDEAGPGRMVVYSLADSAEGS
FSIDKSSGIVILERILDREVQPTYQITVHASDQGSPLPLSSSVNVTITVLDINDNPPVFE
RRDQLATVPEDMGVGTEVLRIYAASKDIGTNAEITYSIRSGNDHGKFHIHPLTGAILVAR
PLDYEACKEYFLTVEACDGGTPSLSAITTVNINLTDVNDNAPMFSREIYTAVVSEDATTG
DSVVQLLAEDVDSPVNGAILYSVVSGDQDSQFFIDPLRGVIRVNKPLDRETVPSYSLAIR
ALDSGTPPMSSTVIVNIDVSDINDNPPTFFPANLTTVIQENKPIGTSILQLSVNDQDSSR
NGEPFDFHILSGNEGGEFVLEKDGTLVANQVFRRDLATEYAIIIQVTDSGKPRMSSTSML
TVRVIEESLHRPVALPLQVHIVTMEDEFPGGVIGQLHATDADPYDALTFGHAPLAQRSLF
KISPRDGKIIALGGLDAGRYALNASVSDGRFAVPVPVSVHVEQVTPEMLREAVTIRFESV
APQDFVALHLKSMLKVLRKAASSQQRDKLHLLSLQPVGGTQQLDMLVAVETAGGGYYKTA
YLTQKLSASRRQLEEVLRVSAILDKNCSGLECRGAQCEQSILLDSHSLATYSTPRVSFVS
PRFHRTSHCTCNDANCAVLSEQCEGQPCPADMQCVSIQATRGHYACQCPTGKLGECAGHS
SLSFSGNSYIKYRLSEWLQEELKVSLRIRTLQRRGIIMYTHTEPCLVLKLEDGKLWFQLA
CGLGSDGGDNPDMLGISGHHINDGSWHTVALELNRNFSSVALDDSYVERRSAAPFTQPLS
PDRSIYFGALVQPPNSRSLVDSQKDPQVLEGFQGCLDSVTLNNNELPLQNKRSRYAEVVG
LTDLKLGCILYPDACLQQPCRNAAICTSLPSGGYVCKCGCMCVCLVISKTNCLFDFVCLL
GFSCTCKPQYTGGRCEMEITACIPNPCQNGGACRPIGNAFLCSCRRGFKGLICEEDVNEC
DQGNPDGECDNSGVCVNTYGSFYCNCTAGFVGQRCGLRPVVVPDMQAGHTVVGKEELIGI
AVVLLVIITLILLFIAFRKKVFQKNYSRNNLSLVQDPATAALLNKANGVQFKTLHCTPGP
PQVPVRPMAYTPCFQGDPRSTLEKLVDGRGVEHTEMSTFHPESPRILSGTTRRGIVVCSV
APNLPPVSPCRSDCDSLRKSPWDDEGKSVCLLFTTNCLMKNIIILKHSQPRSNKSSNSEV
QSLSSFQSDACDDNAYHWDTSDWMPSTRLSDIEEVPGYEAGPGINVAGTAPRLEGSTREL
ESDYYLGGYDIDSDYPHPHEEEFLSQDQLSPPLPTGEDYAELYVPLPTNTPISKDSTLSS
GSTGHQHALPRFHPSQYLP
Download sequence
Identical sequences G3N5G0
ENSGACP00000000533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]