SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000662 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000662
Domain Number 1 Region: 25-259
Classification Level Classification E-value
Superfamily DNase I-like 1.58e-19
Family DNase I-like 0.0000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000662   Gene: ENSGACG00000000518   Transcript: ENSGACT00000000662
Sequence length 285
Comment pep:known_by_projection scaffold:BROADS1:scaffold_139:196653:202448:-1 gene:ENSGACG00000000518 transcript:ENSGACT00000000662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSSPRLPPFSFFILLLEVVTASEFTICAYNAERFDEAKASDFRLLHTVNRIVSRCDIC
LLQDVVDSKAIETLLESLNRESDRYDSYGYQSVSSESLGNSPDDMQKYVFIYREQNVNVT
GKHQYQNKTAFLRAPFAVQFQSEKTAIGSFVLVPLHSDALQAVQEIDRLYDVFEEVTEKW
NNTNVMFLGDFHASCAYVTRADKKNIRLITNSSFSWLIGDKVDTTISSDTNCAFDRIVVH
GEPFLKTISPFSAKVFNYMKDFKLPKREVCVSPLCDKELFIVPSR
Download sequence
Identical sequences G3N5T8
69293.ENSGACP00000000662 ENSGACP00000000662 ENSGACP00000000662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]