SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000693 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000693
Domain Number 1 Region: 1810-1933,1961-1998,2033-2114
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.75e-32
Family Tandem AAA-ATPase domain 0.021
Further Details:      
 
Domain Number 2 Region: 1493-1539,1655-1859
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.11e-23
Family Tandem AAA-ATPase domain 0.032
Further Details:      
 
Domain Number 3 Region: 2145-2366
Classification Level Classification E-value
Superfamily DNase I-like 5.76e-19
Family DNase I-like 0.06
Further Details:      
 
Domain Number 4 Region: 2-182
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000000000196
Family M48USP-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000693   Gene: ENSGACG00000000540   Transcript: ENSGACT00000000693
Sequence length 2367
Comment pep:novel scaffold:BROADS1:scaffold_298:13086:20315:-1 gene:ENSGACG00000000540 transcript:ENSGACT00000000693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRASHSQASIRYGRSRNRQCTCNSLTFLAFLHENESITRADLDHVLDKGNTMYRETRKQV
TNHIYLTTDELTDEVPARSATHHADMTQLSRYGTLGEPLPGAVDSFLDLESGLSCLLSDV
KYALLLMRLLCIAVFRTKSGRYGFFDPHSRTARGLPLPAGSRTPGTAVMVTFSRLSDMID
RLKKSHRMMDTQSSCNYELKPVEFYNMNTVNLNGGLPNTDCRPTAVPVDESNSPTATDQT
SSPETTPHTPAVNQPEVLITTSSHDAPHNESGSTAQVINPVLSDPSDDILTAESSDIIFT
SSVRQEVIKSNEPELSTKSTFLPSHDASLNEGISCNLTKCDKNKRRKIKRRLMISVKTLQ
RKEIKKRKEREKYASNKAYKADKISHAKSQYQNNPEFRQKKINNTRDNVDLKQKRKEYIS
SRYRENADYRQKKKQIFVSRYRNNPQFREKRKQILVSRYRNDPQFREKQKEILVSRYRNN
PEFREKQKEILVSRYRNNPEFREKQKQHFTDRYRDNAEFRKEKKLYFTAFYKNSIDFRQK
KREKERSHIIQRYAHDQAFRLRHKQLMKQRMKDRYKNNPTYKSMRNMRCAMKIKRKYRGI
NNPTEESDNSLIKEAISVFRSQIKSGPTYVCTVCHKASFPNQVKPCKRLNYVRNPDVVAA
CLTGKYVHVCDDQCRDEQQCNVPDERKEEWICHTCHNHLKDGVMPTLAVANNLELADIPP
ELCDLNILERHLIAKCIAFAKIVPLPKGRQRAIHGNVVCVPSEVQETVEALPRLRSESQV
MRVKLKRRLCYRGHQLFQTVTWSKLVQALHKLKRIHPQYQDITIRDEAELCDPTLLKEID
MCEKSALCETETELDGEQDVDMLSCDGEQPEQQRDDEEQEGEMPNGGFALESCLQPCDVS
EEILCFSEGIYSVAPAESNSPVGFFKTPKLEAMAFPVQFPTGQNTLDEGRRMKVTPSSYF
KARLFCVDDRFARDTNYLFFAQFVTEIHLATSSMTIQLRKGKPMTRDGRKITSGMLQNKR
EVEKLVRNKDAVRFMQPLRGTPAYWEKTTRDLFAMIRQLGTPTFFCTFSAAEMRWPEVIE
AIKRQQGEEVNFEGLDWSAKCDILRSNPVTTMRMFDKRVEALFRDVLLSPAQPLGKVVDY
FYRVEFQHRGSPHIHCLIWVEGAPVFEEDDDKTVSDFVSKYITAQLPDQLTQPELYKKVT
EVQIHSKKHSRTCFRSPSSGCRFGFPKPPSRKTMISRPGEGVAPLQLQIAKSKLQPLNLL
LNEPETASLGLQQLLVKCNLTLQEYEGCLNIINKSSAVILKREPKDCWVNGYNAHLLEAW
DANIDVSYILNAYSCIMYLTSYITKKESGLSEYLKTVIENSTKDHVNECDEMREIMQAYS
KKREVSAQECVTRACGINMKKCSRGVIFVPTDDNALKMSRPMSYLENTTLESVNVWMTSL
TDKYKSRPETPEFEQMCLADFAATCRIVYGQQKKGKDVLPLLNDMGFVQKRKNDKPAIIR
FYRCSQEKYPEKFYGTLLKLYIPHRSDLELKRRHFPTYESFYKSGCVQLPGSDHPEYVRH
IVKRNKDKYEKNSEDIENAVEEFEQNRGVIDEWCNLAPESEVERLECIEELEAREPDHEN
VQENVPEYTNQGNAATEARAIREPPAFDPTLLRQMYQNLNQKQACVFYAVRDWCVKRVCG
LNPEQFFFYVNGGAGTGKSHLIKCIYSEASKILCKLPSHSEEVDISNPTVLLTAFTGTAA
FNISGSTLHSLLKLPRSLKPPFQGLGNQLDEVRSELLNAEILIIDEVSMVSKPLFAYVDA
RLKQIKGSPKPFGGMSVIAVGDFYQLPPVRQSKTLCVYEPCEIDLWQEHFQTITLTEIMR
QKDDVAFAEMLNRIRVKGKSDELSQADRALLSQTITEPSLCPPDVLHIFATNKQVDSHNS
VTLALLHSNITNIDADDYKKDPRTGRMARQAQPYKGNRNELPDTLNVAEGARVMLTRNID
VSQGLVNGSFATLVRVITAEQSGVAHVTMLGLKMDDQTAGRNYRNRAPGGPDDVVYIERA
EDNLKQKGVVRRQFPVRLAFACTIHKVQGMTRTSAVVSLKHIFEPGMAYVAISRVTSLSG
LHMLDLDESKIYANPEITGALETMRQVNLDDVMPLLRIKETSSRHDTLTIVHHNTEGLPS
HIIDIRSHHELCLADVLCLTETHLQGSFVAQSLHLEGYNMFKRNRHLSYTNVPQIANRGG
GGVAVYVKSHIQVREKQYVHNVTDLEFVALKVEAPVRALIAAVYRPPDYSVRSFLSNLGS
LLDSLEIMDCQPIIVCGDFNENLFSNTGKPILELFQSRGFAQVITNATTDKNTLLDLIFI
SQPQRCLHSGVMRTYYSYHNPVYCVMS
Download sequence
Identical sequences G3N5W9
69293.ENSGACP00000000693 ENSGACP00000000693 ENSGACP00000000693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]