SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000806 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000806
Domain Number 1 Region: 1238-1503
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-55
Family YWTD domain 0.0000016
Further Details:      
 
Domain Number 2 Region: 2985-3243
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-54
Family YWTD domain 0.00000219
Further Details:      
 
Domain Number 3 Region: 3835-4113
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-46
Family YWTD domain 0.00000682
Further Details:      
 
Domain Number 4 Region: 1860-2116
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-45
Family YWTD domain 0.0000147
Further Details:      
 
Domain Number 5 Region: 1554-1810
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-40
Family YWTD domain 0.0000496
Further Details:      
 
Domain Number 6 Region: 511-753
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-39
Family YWTD domain 0.0000107
Further Details:      
 
Domain Number 7 Region: 177-445
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-38
Family YWTD domain 0.0000694
Further Details:      
 
Domain Number 8 Region: 2169-2438
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-35
Family YWTD domain 0.0000503
Further Details:      
 
Domain Number 9 Region: 2891-2977,3236-3297
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-22
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 10 Region: 49-65,97-166,451-499
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-19
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 11 Region: 3743-3835,4114-4153
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.26e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 12 Region: 824-865
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000576
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 13 Region: 1150-1230,1496-1549
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000165
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 14 Region: 2661-2698
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 865-907
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 16 Region: 3325-3369
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 3568-3603
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 18 Region: 3526-3565
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.00061
Further Details:      
 
Domain Number 19 Region: 950-987
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 20 Region: 990-1028
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000628
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 21 Region: 3487-3527
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 22 Region: 906-944
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000124
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 23 Region: 2705-2740
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 24 Region: 1033-1073
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00016
Further Details:      
 
Domain Number 25 Region: 2746-2780
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 26 Region: 3444-3483
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 27 Region: 3610-3654
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 28 Region: 2788-2824
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 29 Region: 3-42
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 2566-2607
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 31 Region: 3407-3442
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 32 Region: 3697-3736
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 33 Region: 3651-3689
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 34 Region: 2860-2901
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 35 Region: 3288-3322
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 36 Region: 3367-3405
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000641
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 37 Region: 2490-2528
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 38 Region: 1079-1119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 39 Region: 2526-2567
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000563
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 40 Region: 1813-1854
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000153
Family EGF-type module 0.016
Further Details:      
 
Domain Number 41 Region: 2625-2655
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 42 Region: 1810-1854,2126-2162,2439-2491
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000518
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 43 Region: 4204-4239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000754
Family EGF-type module 0.031
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000000806
Domain Number - Region: 4348-4384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 4277-4309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000456
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 4171-4200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000503
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 782-826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000718
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 4239-4274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 2825-2848
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0645
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000806   Gene: ENSGACG00000000618   Transcript: ENSGACT00000000806
Sequence length 4519
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:1422503:1481099:1 gene:ENSGACG00000000618 transcript:ENSGACT00000000806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APKTCSPKQFVCKDGVTCISKGWRCDREKDCPDGSDEEPDVCPHSTISRCPPNEHQCGGT
DLCIHMSKLCNGAPDCTDGWDEGPHCRVFIANCSLVGCQESCAVTPAGPTCYCKSGYEIS
ADGKTCKDFDECSLYGTCSQTCSNTEGSYTCSCVEGYLSQPDNRSCKAKNVPVDRLPVLL
IANSQNIQATSLSGTAVHSLLSTSTKQTTAMDFLYAEETVCWIHVGEAPSSTHLKCAKIP
NLKSFTEERVINISLSLHHVEQMAIDWLTGNFYFVDDVDDRIFVCDKDGQTCVTLLDQEL
YNPKGIALDPIVGKVFFTDYGQIPKVERCDMDGQNRTKLVDSKIVFPHGITLDLVSRLVY
WADAYLDYIEVVDYEGKNRHTIIQGLLIEHLYGLTVFENYLYATNSENANMQPKTSVIRV
NRFNSTDYQVVTRVDKGGALHVYHQRRQPPVRSHACEVDQFGKGGGCSDICLLGNGHKTR
TCRCRSGFSLGNDGKSCKKPEHELFLVYGKGRPGVIRGMDMNAKVPDEYMIPIENLMNPR
ALDFHAEGEFIYFADATNYIIGRQKIDGTERDTIVKEGIHTVEGIAVDWMANNLYWTDDG
PKKTISVARLEKASQTRKTLIEGKMTHPRAIVVDPLHGWMYWTDWEEDPKESKRGKIERA
WMDGSNRNVFLTSKTVLWPNGLSLDIPQGILYWVDAYYDRIEMVYLNSSERKRQTVYEGQ
ELNHAFGLCHYKHFLFWNEYRSGSIYKLDTTTGIASLLRNERPPIFEIRMYDAQQQQDSN
ACRVYNGGCSSLCLAIPGGRQCACAEDQILEPADNTSCKANPSYVPPPQCQPGEFACKNN
RCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCKNNRCIPLRWLCDGDNDCGNDE
DESNTTCSARTCPPNQYSCASGRCIPISWTCDLDDDCGDRSDEPASCAYPTCFPLTQFTC
NNGRCININWRCDNDNDCGDNSDEAGCSHSCSIAQFKCNSGRCIPNYWTCDGDNDCGDYS
DETHANCTNQATRPPGGCHTDEFQCRLDGLCIPLRWRCDGDTDCIDLSDEKNCEGVTHMC
DPAVKFGCRDSARCISKEKLCDGTDDCPDGSDEKLCVCILKACLHRVEQQFCGAFPGVSL
LIRSFSKNIFTDLCSLDNGDCSHNCTVFPGEGVICSCPLGMELGLDNKTCQIQSFCAKHL
KCSQRCEQDKFSVKCSCYEGWELEPDMENCKSTDPFKPFIIFSNRHEIRRIDLNKGEFSV
LVPGLRNTIALDFHLGQNALYWTDVVEDKIYRGNLSENGALTSFDVVIQYGLATPEGLAV
DWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGEVEHPRAIALDPRDGILFWTDWDASLP
RIEAASMSGQGRKTIHKETGNGGWPNGLTVDYLERRILWIDARSDAIYSAKYDGSGLIEV
LKGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKWTGGNVTVVQRTNTQPFDLQVYHPS
RQPQAPNPCAANKDGKEPCSHLCLINYNQTFSCACPHLMKLSPDKRTCYESRQFLLYARQ
IEIRGVDIDNPHYNYIISFTVPDIDNVTVVDYDALEHRIYWSDVRTQTIKRAFINGTGVE
PVVSADVPNAHGLAVDWVSRNLFWTSYDANKKQINVARLDGSFKNAVIQGLDKPHCLVLH
PILGKLYWTDGDNISIANTDGSNRSVLFSGQKGPVGLSIDFDTEYLYWISSGNSTINRCK
LDGSGLEVLDGVKGKLTKATALAIMGEKLWWADQGTDQIGTCDKKDGGNWKILRNSTSPM
MHMKIYNETVQRGTNLCSNNNGDCSQLCLPTSPTTRACMCTAGYSLRTGQQSCEVGVGSF
LLYSVHEGIRGIPLDPLDKSDALVPVSGTSLAVGIDFHADNDTIYWVDMGLSTISRAKRD
QTWREDVITNGIGRVEGIAVDWIAGNIYWTDQGFDVIEVARLNGSFRYVVISQGLDKPRA
ITVHPAKGYLFWTEWGQYPRIERSRLDGTERAVLVNASISWPNGISIDYEESLLYWCDAR
TDKIERINLETGENREVVLANNNNDMFSVSVFESYIYWSDRTHANGSIKRGNKDNATDSV
SLRTGIGVQLKDIKVFNRARQQGTNVCKDKNGGCQQLCLFRGNGQRTCACAHGMLAEDSS
SCRDYEGYLLYSERTILKSVHLSDENNRNAPIKPFEDPEHMKNVIALTFDYRGGGGKGAN
RIFFSDIHFGNIQQISDDGSDRKTVVENVGSVEGLSYHRGWDMLYWTSYTTSTITRHTVD
QSRWGAVDRHTVVSMSGDDHPRAFVLDECQSLMFWTNWNEQSPSIMRATLAGSNVLVIIG
SDIRTPNGLAIDHRAEKLYFSDATLDKIERCEYDGTRRYVVLKNEPVHPFGLSVYGDYIF
WTDWVRRAVLRADKYTGGDMKVLRNDIPQQPMGIVAVANDTNSCEFSLCRVNNGGCQDLC
LLTSEGRVNCSCRGDRKLLEDNTCIALNTTCNNIDEFECGNGDCINYTLTCDGMAHCKDK
SDEKQSYCANRVCKKGYRRCVNSRCVGHSSWCNEQDDCGDNSDEVFCNTTLCTADQFQCK
DGGCISNSSKCNQKVDCADASDETNCTATDCSSYFHLGVKGVTFQKCEFTTLCYAPSWLC
DGANDCGDFSDERNCPGSGKTKCPTPFFACPSGRCIPMSWTCDKENDCENGADEAHCVFL
DLLDKFCSASQFECGNHRCIPNRWVCDGADDCGDSSDEDTKCKTKTCSPEAFQCPASHMC
IPQRWKCDGDKDCPDGADESVKAGCVFNNTCSGEEFMCQNRQCIPKHFVCDHDNDCSDGS
DESQECEYPTCGPNEFRCANGRCLIQSSPKNPHCTGPEKKCNDTEYSCNNGNCLNDTLLC
DHKDDCGDGSDELNCFINECLNSKLSGCSQLCEDLKIGFKCRCQTGFRLKGDGKTCTDID
ECTTTYPCTQRCINTHGSFHCLCVEGFQLSPENPTICKSTSDEEPFLIFANRYYLRKLNL
DGSNYTLLKQGLNNAVALDFDYRQQMIYWTDVTTQGSMIRRMHINGSNVQVLHRTSLSNP
DGLAVDWVGGNLYWCDKGRDTIEVSKLNGAYRTVLVNSGLREPRAVAVDVRYGYLYWSDW
GDTPHIGRIGMDGSNRSAIVEDKITWPNGLTLDFINDRIYWADAREDYIAFASLDGTNRH
TVLVQDIPHIFAMTLFEEYIYWTDWETKSINRAHKTLGINKTVLISTLHRPMDVHIYHPY
RQPEVAEHPCQINNGGCSNLCLLSPGGGYKCACPTNFYLAADGRQCLSNCTASQFVCKND
KCIPFWWKCDTEDDCGDRSDEPADCPEFKCRPGQFQCGTGICTNPAYICDGDNDCQDNSD
EANCDIHVCLPSQFKCSHPSRCIPGIFRCNGQDNCGEGEDEKDCPEVTCAPNQFQCAITK
RCIPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDAS
DEPKEECDERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEDKCVPRQCSESEFSCTN
GRCIAGRWKCDGDHDCADGSDENGCDVKCDSDQFQCKNGHCIAIRWRCDADVDCLDGSDE
MKCDSGVGRHCPLDEFQCNNTLCKPLGWKCDGEDDCGDNSDEDAEHCVNFQCPPTRQFRC
RNDRVCLSLSKRCDGVNNCGDNSDEVNCLTPAASVPPTPVCQKDEFQCSSGRCISSVLRC
NYFNDCEDYGSDEVNCNKKDTVLNDCRSNRTVCGDGDEAHCVVNGTDSFCSCKPGFQSNG
RNSCEDKNECKQFGVCSHICNNTKGSHKCSCYKYFSRINDTCKADGEYFHHKQVLYIADD
SEIRSLDPSMPNWRYEQVFQGDANVRIDAMDLHVKENRIYWTNWHTGRISSYDLPSSSSS
PNSNRNRRQSDSRVTNVEISDLKMPRGIAVDWVAGNLYWTDSGRDVIEVAQIGGGRYRKT
LISGMIDEPYAIVVDPQRGKMYWADWGNHPKIETAAMDGTMRETLVDENIQWPTGLAVDY
FNERLFWADAKLSLICSVRLNGSDVVVAVNSITNREFHKPFGIDVFEDYIYGVTYINNQV
FRVNKFGKGPIENLTTGLNHASDIALYHRYKQPEITNPCDKKKCEWLCLLSPSGPVCICP
NGRTLDNGTCLELPTPTQSPISPPSGPCLVQCMNGGSCFLNAHKQPKCHCQPNYGGDRCQ
IDLCRDYCKNGGTCTPSPTGSPTCRCPTGFTGPNCNLHTCKDYCKNGGNCTVSAGNQPTC
SCPLSLLGDRCQYRSCEGHCLNEGTCLESESGSKLCRCLPQYTGSTCEIDKCHYCRDGEC
IPSNAFTSTGDFTCRCSNGRVQPSCYTCDTNEYCATGQCSINPVSRLPECRCSPGWTGYR
CESVATRDDSSSSGTASIVIPVVLLLLLVLLAAGTLIWYRRRMRGAKGFQHQRMTNGAMN
VEIGNPAYKIYEGEPDDDAGELLDADFALDPDKPTNFTNPVYATLYMGAHNSRNSLASTD
EKKELLSRGDEEPLVDPLT
Download sequence
Identical sequences G3N682
ENSGACP00000000806 ENSGACP00000000806 69293.ENSGACP00000000806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]