SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000809 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000809
Domain Number 1 Region: 389-654
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-56
Family YWTD domain 0.0000016
Further Details:      
 
Domain Number 2 Region: 287-381,647-700
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000769
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 2-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 4 Region: 89-126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000563
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 5 Region: 46-83
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000589
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 6 Region: 129-167
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000825
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 7 Region: 172-212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00016
Further Details:      
 
Domain Number 8 Region: 258-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 9 Region: 221-255
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000809   Gene: ENSGACG00000000618   Transcript: ENSGACT00000000809
Sequence length 705
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:1448615:1456234:1 gene:ENSGACG00000000618 transcript:ENSGACT00000000809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPQCQPGEFACKNNRCIQERWKCDGDNDCLDNSDEAPELCPPPFWILARTCPPNQYSCAS
GRCIPISWTCDLDDDCGDRSDEPASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDN
SDEAGCSHSCSIAQFKCNSGRCIPNYWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTD
EFQCRLDGLCIPLRWRCDGDTDCIDLSDEKNCEGVTHMCDPAVKFGCRDSARCISKAWVC
DGDSDCEDNSDEDNCEALVCKLSHHVCANDSTICLPAEKLCDGTDDCPDGSDEKLCVCIL
KAYLCSLDNGDCSHNCTVFPGEGVICSCPLGMELGLDNKTCQIQSFCAKHLKCSQRCEQD
KFSVKCSCYEGWELEPDMENCKSTDPFKPFIIFSNRHEIRRIDLNKGEFSVLVPGLRNTI
ALDFHLGQNALYWTDVVEDKIYRGNLSENGALTSFDVVIQYGLATPEGLAVDWIAGNIYW
VESNLDQIEVAKLDGTMRTTLLAGEVEHPRAIALDPRDGILFWTDWDASLPRIEAASMSG
QGRKTIHKETGNGGWPNGLTVDYLERRILWIDARSDAIYSAKYDGSGLIEVLKGHEYLSH
PFAVTMYGGEVYWTDWRTNTLAKANKWTGGNVTVVQRTNTQPFDLQVYHPSRQPQAPNPC
AANKDGKEPCSHLCLINYNQTFSCACPHLMKLSPDKRTCYGKAEH
Download sequence
Identical sequences G3N684
ENSGACP00000000809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]