SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001000 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001000
Domain Number 1 Region: 37-184
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-21
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 2 Region: 303-412
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000235
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 3 Region: 413-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000377
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 4 Region: 259-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000289
Family EGF-type module 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000001000
Domain Number - Region: 205-249
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.065
Family Complement control module/SCR domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001000   Gene: ENSGACG00000000776   Transcript: ENSGACT00000001000
Sequence length 458
Comment pep:known_by_projection scaffold:BROADS1:scaffold_47:484062:485435:-1 gene:ENSGACG00000000776 transcript:ENSGACT00000001000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMSSLVSTVAALLLTSLLALFFGCSRALGQDLKEDALCNADGCFVVYFQRKTFLDSWRAC
KEKGGNLATIKRREDAATIATLFSNLDLSQSTTGVRVWIGLQRQPRQCTTTRPLRGFSWT
TGDHDTEYTNWQKEDSPSMCSVPRCVVMSYSNQEQTNNYKWLDGSCSVSVDGYLCRYTYK
GMCPALWSEGAGNTLYSTPFNLLSTLLTYLPYGSVATIPCPAGTKEDQSVLCMLKEDGSV
GWSRDSPLCSDPQISHDWCDQDNGGCEHFCRSAGAHVYCDCAEGYQLGDNGQNCELSDVC
KGAPCEFVCLPLSDGYQCACPDGYMLAPDERGCLDADECLHSPCEQLCVNAPGTFECRCW
EGYHPDDEGGCEDIDECVNDPCEHACENTQGSHICHCHLGYSPVPEEPSQCQDIDECQIP
GTCEKMCVNYEAAFACYCEEGYELMPDQYSCRKREEGD
Download sequence
Identical sequences G3N6S5
ENSGACP00000001000 ENSGACP00000001000 69293.ENSGACP00000001000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]