SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001225 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001225
Domain Number 1 Region: 162-262
Classification Level Classification E-value
Superfamily Immunoglobulin 1.79e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 56-131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000022
Family Growth factor receptor domain 0.0035
Further Details:      
 
Domain Number 3 Region: 118-161
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000568
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001225   Gene: ENSGACG00000000948   Transcript: ENSGACT00000001226
Sequence length 291
Comment pep:known_by_projection scaffold:BROADS1:scaffold_323:7460:9494:1 gene:ENSGACG00000000948 transcript:ENSGACT00000001226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLEPTDPADRVAMPGLSGLVLLGDPPQTRCRDYRPGPHVELGEGVTGSRAGGGAAGPCED
RTCAPRTRGCRAGTADACGCCPECANLEGQSCDPGDRAGFYGTCGTGMRCEVDPRSTCVC
EEQKVLCATDGVTYMNVCQFREATFSRPELKTRGRGPCRTVPVIKVPPLSQVNGTGRSLV
FLCEVFAFPMALVEWRKEGRDVVLPGDDPHISVQSRGGPLKFEVSSWLQIEEAALEDSGT
YRCVARNNVGSVSASAVLGVLGEEELSSYLANSVSEMEQLMDATDYEHNSY
Download sequence
Identical sequences G3N7E7
69293.ENSGACP00000001225 ENSGACP00000001225 ENSGACP00000001225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]