SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001357 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001357
Domain Number 1 Region: 809-983
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-31
Family YWTD domain 0.000000476
Further Details:      
 
Domain Number 2 Region: 417-490
Classification Level Classification E-value
Superfamily GFP-like 8.27e-23
Family Domain G2 of nidogen-1 0.0001
Further Details:      
 
Domain Number 3 Region: 374-414,548-628
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.27e-19
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 671-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000378
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000001357
Domain Number - Region: 635-682
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000132
Family EGF-like domain of nidogen-1 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001357   Gene: ENSGACG00000001047   Transcript: ENSGACT00000001358
Sequence length 983
Comment pep:known_by_projection scaffold:BROADS1:scaffold_171:144634:158832:-1 gene:ENSGACG00000001047 transcript:ENSGACT00000001358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRSAAMCARYRSWLWVWSALLSLSDRTRALELRELFAFGAEAGDQQLPPGSDSAAELPLR
GSLFFFQRAFDRVYINTNGLVSFDGPPKEQEYLGKMPAGFGMIAALLGDLEDSDGQGKVH
FRWDSSPEVLSRAAEYVSRAFPRDEGVEPTAALVVTWENMAARGTTGRGDGLGTKRNTFQ
LVVASMESSSCAILLYPRSGLQFVSTSVGGENKLLEAGFNQGLVAGWFWKDSQGTYFRTT
TDEETSVRDLAEKTNSGQNGVWVYEIGSSPFFHAIAPGTVTGLLEEEEEATTPAVEVTPT
EYQPKYPEPESITPGYTEPKTEDYEGPGQSEPEYPEPETITQGYTEPTTEEPQQPQIVVV
DEEEALDVTVFAYNSETCAHNRLKCSAFADCRDYSNGYCCHCRPGFYGNGKDCVAEGKPQ
RMNGKVSGRVFVGNSPSAVELSNNDLHSYMVVNDGRASVAISNIPDALGPSMLPLTPLGG
VIGWAFAXEDYKEVTYGVVGCDRPVRVGGDSKFTATHSARVSVESDLQPVFSLPSSVVFT
GSDPEQTPCSRPTRCDINAACRPAEGLQFSCQCAAGFIGDGRYCHDDDECRSPEICGSNA
VCNNQPGSFHCECSAGFLFASDGKTCIAAEEKRPADPCQGGSHDCDAPERALCSPAGGAA
FACSCLPGFEGDGRLCRDVDECQQDRCHSAAFCSNTQGSYACQCHPGFHGDGFQCSPASS
GRFRPSLKCAFALHALNTLHALHPLNALHAPTCSKHCTCSTCPKHCTCSTCPKCSTCPKC
STCPSIDQAVTPGLGGPTSRLDVHPVPSGTHLLFAQCGKIERVPLDGYDMQQEEAKPLLY
LPDRVVIAVAYDCVEEMVYWTDITEPAISRARLSGGDVVPVVTTGLQSPEGLAIDHVARL
LFWTDSARDTVEVSQLDGGRRRVLHDTDLINPRAIVTNPPYGRLYWSDWNRDGPKIEMSN
MDGTDRSVLVKDDLGLPNGLTFD
Download sequence
Identical sequences G3N7S3
69293.ENSGACP00000001357 ENSGACP00000001357 ENSGACP00000001357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]