SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001445 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001445
Domain Number 1 Region: 3-168
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-50
Family SPRY domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001445   Gene: ENSGACG00000001117   Transcript: ENSGACT00000001446
Sequence length 176
Comment pep:novel scaffold:BROADS1:scaffold_223:73738:74265:-1 gene:ENSGACG00000001117 transcript:ENSGACT00000001446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSCELTIDTNTVNKQLKLSDNNRKVTRVEEDQSHPDHPDRFDICHQLLCRTSLTGRCYWE
VEWRGRVIVSVSYRGIRRKGNSRDCLFGHNDQSWILNCSDKGYSVLHNTTGTRITSSSSS
GRVAVYVDCPAGSLSFYRVSSDTMIHLHTFSTTFTEPLYPGFLFRSLGTGSSVSLC
Download sequence
Identical sequences G3N811
ENSGACP00000001445 ENSGACP00000001445 69293.ENSGACP00000001445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]