SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001496 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001496
Domain Number 1 Region: 623-895
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-78
Family Protein kinases, catalytic subunit 0.0000000011
Further Details:      
 
Domain Number 2 Region: 29-198
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-56
Family Ephrin receptor ligand binding domain 0.00000123
Further Details:      
 
Domain Number 3 Region: 328-541
Classification Level Classification E-value
Superfamily Fibronectin type III 3.95e-31
Family Fibronectin type III 0.00065
Further Details:      
 
Domain Number 4 Region: 912-983
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.32e-20
Family SAM (sterile alpha motif) domain 0.00063
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000001496
Domain Number - Region: 255-386
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000294
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001496   Gene: ENSGACG00000001154   Transcript: ENSGACT00000001497
Sequence length 986
Comment pep:known_by_projection scaffold:BROADS1:scaffold_129:90158:100386:-1 gene:ENSGACG00000001154 transcript:ENSGACT00000001497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGQRSRPSSSCGLLVLLLRLLTCCVAEEELLMNTKLETSDLRWTNHPPEDPQWEELSGL
DDEANSVRTYEICTPDSLSSYWLRTRWIPRGAATTLYVEMRFTMVDCASLNTRHCKETFN
LYYYQSDSDEATPTHPAWMENPYVKVSTVAADHLMKRGVRRSNVKLLRLAPLVGAGLYLA
FQSQGACMALLSVRVFYRKCPPLRSAFAAFPETVPHSLVEQAQGVCVENAVTPPGEQSQP
PSMLCGEDGQWVGQPTSSCACRPGYVAGETNVRCRACPSGQFKPGLGPGVCTLCPDRSNT
LIPGSAYCLCHHGFHRADADPPHAACTGPPSAPRSIVSQINNTCVTLEWSEPLDRGGRGD
LNYRVLCSRCGPASQGLVTSCSPCDDSILYRPAQRGLTRRRVSVWGLRPQSKYTFTVQSL
NGVSALSQSEPASDSVNVTTSRDVVPPAVAGLRRVASSESSLSLEWNVPVVQNQFQILDY
QLRYSPKEGEGAGQWQYVSSRSSSVVVTGLRRAARYRVQVRGRSQAGYGSFSPESSFSTL
PEGVGSQLVVTAALVSMGILMLVATAILALYCYRRRVKDSELTDRSGHYQMGQTMKVYID
PFTYEDANEAVREFAKEIEASFVKIEEVIGAGEFGEVCRGRLRVPGRQENYVAIKTLKGG
YTDKQRRDFLSEASIMGQFQHPNIIHLEGVITTSCPVMILTEFMENGALDSFLRVNDGQF
TPIQLVGMLRGIAAGMKYLSDMSFVHRDLAARNILVNSNLVCKVSDFGLSRFLTENSSDP
TYTSSLGGKIPIRWTAPEAIAYRKFTSASDGWSYGIVMWEVMSYGERPYWDMSNQDVINA
VEQDYRLPPPPECPASLHSLMLDCWQKERANRPRFCDIVSALDRLIRKPASLKVTLAEGH
SGSQPLLDQRVPPSLSSCGSVSEWLRAIKMERYEPSFLQSGFTSLDVVSQLNTDDLLRVG
VTLAGHQKKILTSIQTLKVHKAPPPP
Download sequence
Identical sequences G3N862
ENSGACP00000001496 ENSGACP00000001496 69293.ENSGACP00000001496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]