SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001885 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001885
Domain Number 1 Region: 70-317
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.5e-86
Family Eukaryotic proteases 0.0000998
Further Details:      
 
Domain Number 2 Region: 34-85
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000207
Family Scavenger receptor cysteine-rich (SRCR) domain 0.072
Further Details:      
 
Domain Number 3 Region: 4-39
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001885   Gene: ENSGACG00000001457   Transcript: ENSGACT00000001888
Sequence length 333
Comment pep:known_by_projection group:BROADS1:groupXVI:266049:279597:-1 gene:ENSGACG00000001457 transcript:ENSGACT00000001888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLSCVGKFHCGSSAKCIRLAKQCDGEVDCDNGEDELGCVRLSGRSSVLQVQRGGAWRTVC
SEGWNNWLGMSACKQLGHSRPQYNTRIVGGNISKPGQFPWQVSLHLNSKHVCGGSIITSR
WVLTAAHCVYGFAYPSMWVVHVGLTEQPTHGAQSLAVEQIIYHTGYESGEDYDVALMKLA
TTLPFNGFVAPICLPNFGEEFEEGTMCWISGWGATEDEGETSVVLRSAVVPLLSTKTCNQ
PQVYQGLISSWMICAGYLEGGTDSCQGDSGGPLACEDSSVWKLVGATSWGIGCALRNKPG
VYTRITQALSWIRQQMEIRYGALFKDVTSLQLS
Download sequence
Identical sequences G3N995
ENSGACP00000001885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]