SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001890 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001890
Domain Number 1 Region: 140-391
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.85e-87
Family Eukaryotic proteases 0.0000998
Further Details:      
 
Domain Number 2 Region: 50-155
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-16
Family Hepsin, N-terminal domain 0.034
Further Details:      
 
Domain Number 3 Region: 17-53
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001890   Gene: ENSGACG00000001457   Transcript: ENSGACT00000001893
Sequence length 396
Comment pep:known_by_projection group:BROADS1:groupXVI:267479:279993:-1 gene:ENSGACG00000001457 transcript:ENSGACT00000001893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVVVILALAIGLGVGLSCVGKFHCGSSAKCIRLAKQCDGEVDCDNGEDELGCVRLSGRSS
VLQVQRGGAWRTVCSEGWNNWLGMSACKQLGHSRYMESFFVSLASIEQDLQYSLVSINLS
QSQIIQLQNATTLSKTQCSSGRVTTVKCLECGSRPQYNTRIVGGNISKPGQFPWQVSLHL
NSKHVCGGSIITSRWVLTAAHCVYGFAYPSMWVVHVGLTEQPTHGAQSLAVEQIIYHTGY
ESGEDYDVALMKLATTLPFNGFVAPICLPNFGEEFEEGTMCWISGWGATEDEGETSVVLR
SAVVPLLSTKTCNQPQVYQGLISSWMICAGYLEGGTDSCQGDSGGPLACEDSSVWKLVGA
TSWGIGCALRNKPGVYTRITQALSWIRQQMEVSTQP
Download sequence
Identical sequences G3N9A0
69293.ENSGACP00000001890 ENSGACP00000001890 ENSGACP00000001890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]