SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002247 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000002247
Domain Number - Region: 91-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0504
Family RecA protein-like (ATPase-domain) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002247   Gene: ENSGACG00000001728   Transcript: ENSGACT00000002253
Sequence length 253
Comment pep:novel scaffold:BROADS1:scaffold_262:15056:15814:-1 gene:ENSGACG00000001728 transcript:ENSGACT00000002253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSGLPAAVCQRELKSDLKRKFQCVFEGITKAGNPTLLNEIYTELYITEGGTAEVNEEHEV
RQIETASRRPARPETTIRQEDLLKASAGGEEPIRTVMTKGVAGIGKTVLTQKFTLDWAED
KDHQDIQFTFPFTFRELNVLREKKFSLVELVHHFFSETRAAGICRFEEFQVVFIFDGLDE
CRLPLDFHNNEILTDVTESASVDVLLTNLIRGKLLPSARLWITTRPAAANQIPPECVGMV
TEVRGFTDPQKEE
Download sequence
Identical sequences G3NAA2
ENSGACP00000002247 ENSGACP00000002247 69293.ENSGACP00000002247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]