SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002273 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002273
Domain Number 1 Region: 146-207
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.5e-16
Family Complement control module/SCR domain 0.01
Further Details:      
 
Domain Number 2 Region: 81-140
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000162
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 3 Region: 33-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000197
Family Complement control module/SCR domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002273   Gene: ENSGACG00000001733   Transcript: ENSGACT00000002279
Sequence length 208
Comment pep:novel scaffold:BROADS1:scaffold_609:6299:11347:1 gene:ENSGACG00000001733 transcript:ENSGACT00000002279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTCFHLAKQIDHIIIIQISISLLLEVTCSNQKPQHVDNWGVPWRGRITLDETARYSCVKD
YKKPVGFDLATCTREGWTPNPLCQDSLDCGSPPFLTNGDTTETSRSDYKHDEKVHYSCKA
YHTLEGGPYRTCKNGKWIGEMKCLKPCTVDEEAMRSHNIRFRHKPDDKLYSVHLEWIGFT
CTSGTSHVGTIGMRQMCVDGVMLLPTCQ
Download sequence
Identical sequences G3NAC8
ENSGACP00000002273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]