SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gasterosteus aculeatus 76_1 > ENSGACP00000002312

Domain assignment for ENSGACP00000002312 from Gasterosteus aculeatus 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSGACP00000002312
Domain Number 1	Region: 141-201
Classification Level	Classification	E-value
Superfamily	TB module/8-cys domain	0.000000000000249
Family	TB module/8-cys domain	0.0017
Further Details:

Domain Number 2	Region: 16-77
Classification Level	Classification	E-value
Superfamily	TB module/8-cys domain	0.0000000000235
Family	TB module/8-cys domain	0.0016
Further Details:

Domain Number 3	Region: 89-136
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.000000000737
Family	EGF-type module	0.0048
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGACP00000002312 Gene: ENSGACG00000001780 Transcript: ENSGACT00000002319
Sequence length	220
Comment	pep:novel scaffold:BROADS1:scaffold_1088:48:4563:-1 gene:ENSGACG00000001780 transcript:ENSGACT00000002319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	VQAQTVRGAGPISQQAGFKYCFREVKDGQCSSPLPGLRSRDICCQGIGKAWGTTECVLCP DTTGTTECVLCPDTTGKSNSSCPAGFERDNGMQCVDVNECLQPGLCENGICVNTRGRYSC VCRAGFILDASHGICISQSVISEEKGQCHRVLGSGRGPTSCSLPILRSITKQICCCSRVG RAWGPDCQRCPHFGSGGRRSLAHTGPGTGPADSPAAANQR
Download sequence
Identical sequences	G3NAG7 69293.ENSGACP00000002312 ENSGACP00000002312 ENSGACP00000002312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]