SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002970 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002970
Domain Number 1 Region: 324-533,571-636
Classification Level Classification E-value
Superfamily DNase I-like 1.34e-39
Family Sphingomyelin phosphodiesterase-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002970   Gene: ENSGACG00000002282   Transcript: ENSGACT00000002981
Sequence length 646
Comment pep:known_by_projection group:BROADS1:groupXIX:758037:774980:-1 gene:ENSGACG00000002282 transcript:ENSGACT00000002981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLHATPYSGACLHFLDGLSWSLVFPCYWLLDQLLASCVATSLEKRRRSRDPCSFLTLCV
LVSAPLYLLLLLASLPLALLGFVIWAPLQAVRQPYLYTHRRSEEHGRRESKSLGEWRPQG
RSFCFCSANVCLLPDSLARFNNLSDTHRRAREVGKRIRNGASRPQIKIYIDSPTNTSISA
ASFSSLATGFRRTSSLDHRPDQTHTTNGPADPEGAQGGQDHHDCPVHGDVAQTKPSSDCP
LHASAVQISISAPEPEPEEKEAETGNHRPGEQAGGDTGSMTASRESLARYHGGDGGVGIC
SNNTLSHVPRTSIFKRPGRKRRHGDETFDHDISAFFPANLDFLALQEVFDHGSTTRLRHQ
LHRYFPYVLSDVGRYGWKGCCSRFKFLNSGLMLASHYPILDARFECYPNGRGEDALAAKG
ALFAKVHVGTSHQEQRVVGYLTCTHLHAIEAGDASVRCEQLDLLLQWGAQFRQSSSRPAE
GEKVPEDLVAFDVVLGDLNFDNCSSEDKLEQQHALFTQYKDPCRLGPGEDKPWALGTLLD
PGGLYDDEVSSPESLQKVMENEDARKEYLVFPPSKSQCPGSSQKGRKIPLKGNGRRIDYM
LYSDEGLQPDWKLEIEEFSFVTQLAGLTDHLSVAMRLAVSTGEEEP
Download sequence
Identical sequences G3NCC1
ENSGACP00000002970 ENSGACP00000002970 69293.ENSGACP00000002970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]