SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003013 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003013
Domain Number 1 Region: 69-135
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000554
Family Ovomucoid domain III-like 0.0054
Further Details:      
 
Domain Number 2 Region: 169-227
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000025
Family Ovomucoid domain III-like 0.0052
Further Details:      
 
Domain Number 3 Region: 270-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000586
Family EGF-type module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003013   Gene: ENSGACG00000002314   Transcript: ENSGACT00000003024
Sequence length 383
Comment pep:known_by_projection group:BROADS1:groupXVI:5142264:5223303:-1 gene:ENSGACG00000002314 transcript:ENSGACT00000003024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNYWLHPAPRESRRLCPNFSWLRITLVSFLATLPVEQLRAFPSSLSDCQTPTGWNCSGFD
DRDTDLFLCDTNTCKFDGECLRIGNMVTCICDFKCNNDYAPVCGSNNQNYQNECFLRRDA
CKQQSEVLIMSEGACPADAGSGSGDDGGEGSAEAGQKETSTCDICQFGAECDVDAEDVWC
VCNIDCSHISFNPVCASDGRSYDNPCQVKEASCQKQERIEVKYLGHCRKGNTFTFVLTHS
SFYCDINIDARTDNTVKEKEDTRNELARGLYIPCPDHYKNYCVHGECQFPSIVAQPSCSC
HSGFRGPQCDVKEYNVLYVVPGSGKLHYVLIASIIGALQVVIICVVVLCITRKCPRTNRI
NRQKQNNVHFSTENTMRASTRLI
Download sequence
Identical sequences G3NCG3
ENSGACP00000003013 69293.ENSGACP00000003013 ENSGACP00000003013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]