SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003424 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003424
Domain Number 1 Region: 205-332
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000022
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 682-802
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000722
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 467-593
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000769
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 911-964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000105
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 89-209
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000151
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 6 Region: 564-689
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000251
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 7 Region: 802-913
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000581
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 8 Region: 354-444,473-517
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000926
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 9 Region: 4-89
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000424
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 10 Region: 955-993
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000496
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 996-1032
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000187
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003424   Gene: ENSGACG00000002616   Transcript: ENSGACT00000003435
Sequence length 1047
Comment pep:novel group:BROADS1:groupVI:1013346:1017880:-1 gene:ENSGACG00000002616 transcript:ENSGACT00000003435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNECTNQRICHWNATCTNNPGSYMCTCNAGYKGNGNYLCLDVDECSQAPPVCSSTLGYTS
CINLPGAFRCTCSSGYETNGQRCVDVDECARNVCSLYALCINTVGSYRCTCNSGFDGNGL
TCADVNECNGNNQCDPSAACINRIGSYECSCFGGFIGDGRLCEDINECANPNICPSTTTC
VNTPGSYYCDCGSGFVFNNSICFDQDECSEGRCSPFANCINSPGSFSCQCIAGYTGDGFT
CRDVDECTLAKQCHSNGFCINLPGSYNCTCQVGYSGDGVIQCTDVNECLVDNGGCRNKAL
CVNNRGSFSCQCQSGFILVNQTLCQDVNECVERINPCRVNEGASSAPVSGVSKDVDECAL
SDTICPAYSKCINSPGAYVCSCLNGTVAFNGTCMPPSPLCNPPCHSHGLCHQSPAGYQCV
CDLGHVGDGLACSDIDECKFWYGIATSMKWEIELTFTNDNNDKLSICCHFDECQVQNGGC
HPVASCHNTPGSFYCACPPGTTGSGFDCQDVNECDQNSTLPHNCSTRALCSNTNGSYICQ
CQDGYQGDGFVCVDVDECREANTCSGNMTCNNTPGSYTCWCILGLVYDEGTCVTKDTCLN
ANSICDPFAKCRQHQGSFYCKCKDGFNGNDNGTHCQDVDECVTRNFTCPDNSTCANMEGS
YKCACNPGFSGNGSVCLDVDECSLGFVRCPKFSYCLNTIGSFVCECWEGYEGNNTHCEDI
DECQDNSTCPKHSTCINTNGSHVCRCKDGYSRLDALCVDIDECNDTQLVDLCTNGTCMNA
IGSYYCECIKGFWNSLNSSVCRNHSTCVNLPGSYRCPCNQGFVLNGAECQDVDECNSADG
PPCPEHSLCSNTAGSFFCLCSPGYKTIGARCEDINECKNNTTCRFDQVCTNIPGTYNCSC
PLGHREEKGACVDTDECESSPCHRSARCWNTPGSFSCHCSLGFAGNGSSCKDVDECVALT
KPCHPLARCLNTPGSFVCVCQPGFVSIGPLCVDFVECEQANALCHPAATCINHAGGFKCS
CGQGWNATEENCSGKRGCVDMDECMSS
Download sequence
Identical sequences G3NDM4
ENSGACP00000003424 ENSGACP00000003424 69293.ENSGACP00000003424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]