SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003511 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003511
Domain Number 1 Region: 50-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-32
Family Spermadhesin, CUB domain 0.00018
Further Details:      
 
Domain Number 2 Region: 169-292
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-18
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 3 Region: 290-326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000511
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003511   Gene: ENSGACG00000002682   Transcript: ENSGACT00000003523
Sequence length 557
Comment pep:known_by_projection group:BROADS1:groupXXI:6189464:6240135:-1 gene:ENSGACG00000002682 transcript:ENSGACT00000003523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHGHSFHHVVASLLILGLSGATRKDTSVKNNSGVKPAGQCGTWVKEPEGGIFTSPNHPN
KYPPDTECVYILEAPPRQCIDLHFDENYSIESSWECKFDNIEVRDGPFGFSPILGRYCGQ
HRPPYIRSSGRYLWIKFVTDGELEAVGFSASYNFTADPDFADMGVPPPLPSCQYDMVGPD
GIVESLQITRDGKADATEAVDCKWYIRAPPRSKIYLRFLDYEMANSNECKRNFVAVYDGG
SSVEDLKNKFCSTVANDIMLVSTLGVIRMWADEASRKSRFRILYTTYQEPPCEPEAFFCH
SNMCINNTLVCNGLQNCVYPWDENQCKEKRKTNILDNLNNTNGTIIGVTCCIVLILLIVS
VIVQIKQPRKKYILRREDFDPTMFQEVFEPPHYELCTLRSATAAAAAASADLVDLAEDFE
NYHGLRRASSRCVHDHHCGSFSNPGSAHLSQLSLSGRGSRGNLSARDSAGGALLADLPQA
PMAVRPLLPSTGNRRSILVMKHSYSQEAADNGCDLEDDLEEVPTTSHRLSRHEKAVQRFC
LIGSLSKHESEYNTTRV
Download sequence
Identical sequences G3NDW0
ENSGACP00000003511 69293.ENSGACP00000003511 ENSGACP00000003511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]