SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003532 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003532
Domain Number 1 Region: 1-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.23e-67
Family Ephrin receptor ligand binding domain 0.00000145
Further Details:      
 
Domain Number 2 Region: 596-868
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-65
Family Protein kinases, catalytic subunit 0.0000000169
Further Details:      
 
Domain Number 3 Region: 300-503
Classification Level Classification E-value
Superfamily Fibronectin type III 8.64e-32
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 4 Region: 891-967
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.3e-19
Family SAM (sterile alpha motif) domain 0.0005
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000003532
Domain Number - Region: 230-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000419
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003532   Gene: ENSGACG00000002696   Transcript: ENSGACT00000003544
Sequence length 969
Comment pep:novel group:BROADS1:groupX:2923308:3005703:1 gene:ENSGACG00000002696 transcript:ENSGACT00000003544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLLNSKETQAELGWTSYPPNGWEEISGVDEKYKPIRTYQVCNVMEPTQQNNWLQTGWVA
RRGGQRIFVELQFTLRDCNSIPGVAGTCKETFNLLYVETDRDLGGVTREDRYTKIDTIAA
DESFTQGDLGERKMKLNTEVREIGHLNRKGFHLAFQDVGACVALVAVRVYYKRCLATVQN
LAVFPDTVAEAAFATLVEVRGACVNNSEVDADSPPRMHCSAEGEWLVPIGKCSCSAGYEE
GHSSCEACPRGSYKMSSRQQECFPCPANSVSEEEGSVVCVCEEDHFRTPLDTPSAPCTRP
PSPPRELLYTLKQSTLILEWAAPSDAGGRVDLTYSVGCRRCVGRQCEPCGASVGFVPQQV
GLTERTVTVVNLLPNTNYTFSVEALNSVSELLPSKRFYTQVNVSTSLPAPSLISELRAEK
IEQKSITLVWRQPSYPNSSRTEYEVKYYEKEQKDQSYSTVKTAATRICVNNLKAGTTYVF
LIRPFSTPDYGAYSAPLELQTLGELTQGKIVCLVALASSEQSPVVIIVVVSVAALIVLLS
MGLGLLIWRRQCGYSKASQEGDEELYFQFKIPTRRTYIDPETCDDLLQAVHAFAKELDNS
SIKIERIVHTGDFGEVCRGCLKLPSKRELPVAIKTLRAGCSEKQRRSFLSEAGILGQFDH
GNIIRLEGVITTGNTMMIIVESMSNGALDSFLRKHEGQLSVMQLMDMLTGVASGMKYLTD
MGFIHKRLAAHQVLVNSNLGCKVSGFRPLQEDKIETIYTSQHGGKSVVLWTAPEAIQYHR
FSSASDVWSFGIVMWEVMSYGERPYWDMGNQDVIKAIEDGFRLPAPVNCPPHLHQLMLDC
WQKERTERPSFSQIHSALSKSIRSPDGIGSSTLARRTLQSSSITIAERPLPSFPSFNSVG
EWLDAVDMGRYKDNFTAAGYCYLESVARMTVQDVLSLGITSLEHQKLILAAIQTLRAQVI
QMHGRGVQV
Download sequence
Identical sequences G3NDY1
ENSGACP00000003532 69293.ENSGACP00000003532 ENSGACP00000003532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]