SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003565 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003565
Domain Number 1 Region: 432-639
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.08e-37
Family Laminin G-like module 0.00097
Further Details:      
 
Domain Number 2 Region: 651-842
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-35
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 3 Region: 846-1026
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.04e-35
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 238-415
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.8e-33
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 5 Region: 3-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.01e-29
Family Laminin G-like module 0.006
Further Details:      
 
Domain Number 6 Region: 1059-1199
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-28
Family Laminin G-like module 0.000012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000003565
Domain Number - Region: 180-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0176
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003565   Gene: ENSGACG00000002720   Transcript: ENSGACT00000003577
Sequence length 1476
Comment pep:known_by_projection group:BROADS1:groupV:1746291:1792725:1 gene:ENSGACG00000002720 transcript:ENSGACT00000003577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEVLEFGGVSSQWGRFPVWNACCESVLSFSLRTHSQEGLLLYLDDEGFCDFLELLLLHGH
LRLRFSIFCAEPAELQSGVAVSDGHWHAVRVKRDWRNTSLEVDGRLEGWAEVKSKRRDMT
VFSHTYMGGVTPELHSSPLRLTSPSVREQPAFRGWITAVSVNGSLASLESSEGVTVTAGC
GPDHQCQNGGVCSVVNGQAACDCADTGFQGNDCSEGDQRVEGLAHLMIGDQVDNKTREEY
VATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSL
VINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTISVDGIL
TTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRL
AKQGDPKMKVSGVVSFKCESVATLDPVTFDTPESFVALSKWSAKKAGSISFDFRTTEPNG
LMLFSHGKPRQQQHKDPRTPPTLKVDFFAIEMLDGHLYLLLDMGSGTTKTKAIDRKVNDG
EWYHVDFQRDGRSGTISVNSVRTAYTAPGDSEILDLDETLYLGGLPEDRAGLIFPTEVWT
ALLNYGYVGCIRDLFVDGQSKDIRRLAEAQRAVGVKPSCSREPPKQCLSNPCQHNGICRE
GWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKVQLPVAMHTEAEDVSLRFRSQRAYG
VLMATTSRNSADTLRLELDGGRVRLTVNLDCIRINCTASKGPETIFAGSGLNDNEWHTVR
VVRRGKGLKLTVDDLQPAEGQMAGDHTQLEFHNVETGIVTEKRFMPAVPSNFIGHLQGLT
LNGMPYIDLCKNGDIDYCELNAVIGYKSIVADPVTFRSRSSFVTLPTLQAYYSMHLFMQF
KTTSPDGLVLFNRGDGNDFIVVELVKGYLHYISDLGNGAHLIKGNSNSPLNDNHWHNVHI
SRDTNNLHTVKIDTKVTTQTTMGAKNLDLKGDLYIGGVSKEMYRELPKLVHSREGFQGCL
ATVDLNGRLPDLLADALATMGQVERGCEGPSTTCQEESCSNQGVCLQQWEGFTCDCSMTS
YAGPLCNDAGTTYIFGRDGGVVIYTWPPNERPSTRADRLALGFSTQQKQAILLRVDSASG
LGDYLQLEIDKGNIRVVFNVGTDDINIEESSKFVNDGKYHIIRFTRSGGNATLQLDDLPV
IERYPSGNIDNERLAIARQRIPYRLGRVVDDWLLDKVGRQLTIFNSQTTVRVGGAERSAG
MFQGQLSGLYYNGLRILNMAAEGHPHIKVEGSARLVGDMPSSSITPQSSAAAGGNRSDSA
PSISDITTTTATNRKQGATQQPLKQSADDLLVASAECPSDDEDIDPCDPSSGENAPPAPR
PPLPEVFPVPSEVVRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRN
YISNSATQPNGSAKDKPLGITKISKNKKNKDKEYYV
Download sequence
Identical sequences G3NE14
ENSGACP00000003565 69293.ENSGACP00000003565 ENSGACP00000003565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]