SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003695 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003695
Domain Number 1 Region: 4-78
Classification Level Classification E-value
Superfamily DNase I-like 0.0000000000446
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003695   Gene: ENSGACG00000002820   Transcript: ENSGACT00000003707
Sequence length 106
Comment pep:known_by_projection group:BROADS1:groupVI:1649709:1655313:1 gene:ENSGACG00000002820 transcript:ENSGACT00000003707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSIKLPPLNYPYSEDSSQGKQYMNTRCPAWCDRILLSPSARDLVLKPENEEKSIVYDNIG
PNVCMGDHKPVFLSFRITAGAGKCCQRREKIFREAPLCGRAPEGPG
Download sequence
Identical sequences G3NEE4
ENSGACP00000003695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]