SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004003 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004003
Domain Number 1 Region: 576-813
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.21e-81
Family Eukaryotic proteases 0.00005
Further Details:      
 
Domain Number 2 Region: 69-203
Classification Level Classification E-value
Superfamily SEA domain 1.96e-22
Family SEA domain 0.0096
Further Details:      
 
Domain Number 3 Region: 236-327
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000628
Family Spermadhesin, CUB domain 0.009
Further Details:      
 
Domain Number 4 Region: 447-484
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000105
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 343-444
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000157
Family Spermadhesin, CUB domain 0.0052
Further Details:      
 
Domain Number 6 Region: 523-562
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 483-519
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000563
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004003   Gene: ENSGACG00000003053   Transcript: ENSGACT00000004017
Sequence length 816
Comment pep:known_by_projection group:BROADS1:groupXXI:7503400:7508618:1 gene:ENSGACG00000003053 transcript:ENSGACT00000004017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQIADVSVEVATVDHTLQKICRKYRKTRRKPKGLKRLQARLLSIPHLAVIITAVVFVVLI
IMWSLLWVFLFRRESNSGVYFAGMFRVANVEFIPEYRQAESREFVSLAGKIQHVVSNVFK
VSSVARLYKQAIISDLSNNDKGGVLVHFWMAFVVPQLRSKSVCEECVEAIFRDSVHISMM
NRSSVGYLLGLPVDMDSILINAVERSDYSSSGAGSQCVGKLYANLPGLSVPLNVFSSWGD
VSCHVKLTSAPGSLIRLTVTSFLIEPSDCVSDGLTAYDALLPMRGRILHRMCEPVSRSFS
LVSTSNVMLLSFRMTNGNKSFRGHFEAIAEEMSQIETHVEPDIIGQIYSPFHPSLLPPQC
FSTWKFETPSSALGVALQFQNYVLKPKEVNGCEHGWWKVNEIIFCGSYVGHHTVFRISDH
SPEVEFRCSSRISAQPFQATYSSYNISQPCPENHFLCSTGLCVEKSRRCDGLDDCQDESD
EVFCSRPTKNCGGNSPLHPLFVCNGESDCPNGIDETNCTQETTCSAIRYQCSSGSCILKK
NAKCDGVLDCQDHSDEADCACGRPSSVKKTGSPPGRERIVGGDNSVEGEWPWQVSLHFSG
QLYCGASVLSSDWLVSAAHCFSKERLSDPRYWSAHLGMLTQGSAKHVAEIQRIVVHEYYD
EYTFDYDIALLQLKKPWPPSLSPLVQPVCLPPSSHAVTDSHRCVVTGWGYRSEDDKVLPS
VLQKAEVSIVSQTDCKKSLGPVSSRMLCAGVASGERDACRGDSGGPLSCQAPGRGRWFLI
GIVSWGSGCGRPNLPGVFTRVNKFTSWIYSHISSLP
Download sequence
Identical sequences G3NFA1
ENSGACP00000004003 69293.ENSGACP00000004003 ENSGACP00000004003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]