SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004011 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004011
Domain Number 1 Region: 157-418
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.68e-91
Family Eukaryotic proteases 0.0000143
Further Details:      
 
Domain Number 2 Region: 19-53
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000707
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 96-127
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000641
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 4 Region: 132-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000327
Family LDL receptor-like module 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000004011
Domain Number - Region: 55-90
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000157
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004011   Gene: ENSGACG00000003060   Transcript: ENSGACT00000004025
Sequence length 419
Comment pep:novel group:BROADS1:groupXXI:7513256:7515484:1 gene:ENSGACG00000003060 transcript:ENSGACT00000004025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLTHKGFHLLYRAFSPEGTCPRQFRCGDGGCIPLRKVCDGVKDCSDGRDEAKCSSCRPGE
VLCGNGQCKPQSSQCVSQSTCADSSEEGACGGKCPHMCSNKVCLPKTSVCNGVIDCKDRS
DELNCTRAYLKGCSSSSYKCANGKCVSKVNPECDGVKDCFDGSDELRCGCGTRPRKRTKI
VGGSDAGAGSWPWQVSLQMERYGHVCGATLVANRWLISAAHCFQDSDAIKYSDARAWRAY
LGMRLMTTGNNGAATRPIRRILLHPQYDQFTSDYDIALLELSAPVFFNDLVQPVCVPAPS
HTFTTGTSCYVTGWGVLMEDGELAAHLQEATVKIINRKTCNKLYDEAVTPRMLCAGNLQG
GVDACQGDSGGPLVCLERGRRWFLAGIVSWGEGCARQNRPGVYTQVVKFTDWIQQQTKG
Download sequence
Identical sequences G3NFA9
ENSGACP00000004011 69293.ENSGACP00000004011 ENSGACP00000004011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]