SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004247 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004247
Domain Number 1 Region: 286-352
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000202
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 2 Region: 344-409
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000125
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 3 Region: 85-144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000223
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 4 Region: 149-207
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000764
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 399-460
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000877
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 6 Region: 240-296
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000944
Family Complement control module/SCR domain 0.004
Further Details:      
 
Domain Number 7 Region: 26-99
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000391
Family Complement control module/SCR domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004247   Gene: ENSGACG00000003245   Transcript: ENSGACT00000004261
Sequence length 464
Comment pep:known_by_projection group:BROADS1:groupXII:1585296:1590540:1 gene:ENSGACG00000003245 transcript:ENSGACT00000004261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDVARIFLLLSFALLASALGQVPEDCSAPPEFPHTRLLKKYTGTRKFSSGEKVRYGCRE
DSAPSAGSTAVRCDAGRWSQLTLKCAKISCGNAGELPHGEFQYEGDTVVGERVYAVCREG
YTLKGLNYMTCKTSGWTGEFPTCVEGETTCSPPAVAHSANRTGEVPVHRAGDHLTFSCAP
GFQLDGAQRITCGPDGLWRPPAPRCLPLPDETRSPDGGAGRCGVPVTGRHSNAELADRYL
GTASFASGDRVHYACGVGHAQAGGSRYRTCVAGKWTPLLLKCERKLCGSAGEILNGQFEY
SGVMFGDKATAVCDEGHRLVGQATRYCLSGGWDGRVPVCEAVACEEPPEETNAVMMDPQE
SGYTYSSVIRYQCRVGTPIGKRNIWCTKDGTWSDPPPKCKVITCPDPNVPHAYWRGRRYK
LFQDRDSVVIHCYPGYRKTGPRAVTCGANGWSPGLPKCNRFSRK
Download sequence
Identical sequences G3NFZ2
69293.ENSGACP00000004247 ENSGACP00000004247 ENSGACP00000004247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]