SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004252 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004252
Domain Number 1 Region: 816-923
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-22
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 2 Region: 287-412
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.16e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 28-155
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.87e-16
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 249-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000117
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 628-811
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000314
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 168-286
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000345
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004252   Gene: ENSGACG00000003249   Transcript: ENSGACT00000004266
Sequence length 1003
Comment pep:known_by_projection group:BROADS1:groupXII:1592910:1631790:-1 gene:ENSGACG00000003249 transcript:ENSGACT00000004266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGTGRLGQCAALSSVHSRPPPPLRLSPCTDVDECAEALDNCSIDAICQNTLKSYKCICQS
GYKGDGKHCEDVDECATEYNGGCVHECINIPGNYRCTCYDGFRLAHDGHNCLADVDECSE
GNGGCQQICVNMMGSYECRCREGFLLSDNQHTCIQRPKAQPDGSKEGPTCMDKNHGCAHI
CRETQKGGIACECRPGFQLTRNMKDCKLTCNYGNGGCQHICEETDHGPKCLCHMKFVLHS
DGKTCVETCAVNNGGCDSTCHDSVTGVRCSCPVGFTLQPDRKTCKDIDECRLNNGGCDHV
CRNTVGSFECSCKKGYKLLTNERTCQDIDECSFDRACDHFCVNSAGSFQCLCHKGHVLYG
LAHCGDIDECSINRGGCKYGCVNTLGSYECTCPPGHKLHWNRKDCVELVKCPLGLLAPKA
TLTCSKTGKKESCSLTCASKAHYLAESDNSYSVSCGIPILRVKTPPGRKVCCPRPTVLCL
SVETLAPPVKQTASFKIKNAKCHLHPKLTGRTEDRGRTLGPGGGQPCSNCLVTFVNLKCD
SSKKTKGRRARNPSNKEVTRITLELEAEVKPGDTTGSCNLSCLRQRMEKQVKTYIKALKK
SINQERFLIRVAGLEYEVAQKLPQAAPSHENCGPGWERDSGRCVRCLPGSYYHGEQERCV
QCPPGTFQEREGQLACDLCPGSDGHGPVGARNISSCAGQCPTGSFSSDGFKPCQPCPQGS
YQPDLGRTLCFPCGGGLGTKREGASFFHDCEVKVQCSPGHYYNTTVHRCIRCPVGTYQTE
FRQNYCISCPGNTTTDFDGATSVSQCKNRQCGGEMGEFMGYIESPNYPGNYPANVECIWN
INPPSKRKILIVVPEIFLPSEDECGDVLVMRKNWSATSITTYETCQTYERPIAFTARSRR
LWINFKSNEANSGRGFQIPYVTYDESEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKT
LFDVLAHPNNYFKYTTRESNEMLPRSFIRLISSKVSAFLRPYK
Download sequence
Identical sequences G3NFZ7
ENSGACP00000004252 69293.ENSGACP00000004252 ENSGACP00000004252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]