SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004373 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004373
Domain Number 1 Region: 108-169
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000135
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 2 Region: 254-312
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000514
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 55-122
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000113
Family Complement control module/SCR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004373   Gene: ENSGACG00000003318   Transcript: ENSGACT00000004387
Sequence length 455
Comment pep:known_by_projection group:BROADS1:groupXVI:7653990:7661008:1 gene:ENSGACG00000003318 transcript:ENSGACT00000004387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMYYLCMLPVQKIQMSPLVQLKSLPSPGSGHYPNGDDEDWYSRRHTGSPWCAPIKVKHGD
VSCRTPRGENYRNVMGTRCKIRCKQGYESQSSEVVCMASKHWSSSYACQEIRCAKLDMPV
NGGYKCSDGSYFNSRCEFFCSPGFILMGQKTATCQYRKTWSAGVPTCVDVEPPKIKCPNL
KDKWAEPAKLTARVTWDTPEGVDTADGILTDVILKGKPSKSNFPEGLHKMSYTVFDRAGN
KGSCRFTVRVRVRRCSALFPPDNGYMKCDSDADNYGTTCEFTCTGGYELRGSAARVCQYG
LTWSGTDTTCAAMNINVGVRTAAALLDQFYEKRRLLVISAPTAANHNYRFQMTNLQHAQC
GLDLRHVTVIELVGTYPAQIGRIRHRLLPPALALQLRLLLQIPQRSFQMVLVDKQGMDKQ
RYPFPITAAELFTTVDTFPLRKDEMVLQQEAGQTC
Download sequence
Identical sequences G3NGB8
ENSGACP00000004373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]