SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004517 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004517
Domain Number 1 Region: 4-79
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000204
Family Growth factor receptor domain 0.004
Further Details:      
 
Domain Number 2 Region: 73-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000126
Family VWC domain 0.058
Further Details:      
 
Domain Number 3 Region: 202-247
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000249
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004517   Gene: ENSGACG00000003446   Transcript: ENSGACT00000004531
Sequence length 356
Comment pep:known_by_projection group:BROADS1:groupXIII:365572:367968:1 gene:ENSGACG00000003446 transcript:ENSGACT00000004531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPAECSCPPSPQPCPPGVSWVTDHCGCCKVCAKQFNEDCSATKPCDHIKGLRCHLGAGGD
PERGLCRAEAQGLPCEFSGRVYQHREDFQPNCQHQCTCMDGVVGCMPLCPRQVPLPYWRC
QRPRLARPEGGCCEEWVCDDSNHISEEPEDLTHTSLPDRLSLPNHINGLLQAPPQPRHPT
AAGGVPRGEMASFPVSTMLHKSSCFAQTTEWTECSTTCGMGISSRVSNDHPDCRLLRETR
LCQIRQCELQPPAASKKGKKCQRTFRPQEPVRITFAGCSTPQRYRPRTCGTCSDGRCCTP
SVSRTVTLRFHCPDGEGFYRKVMWIQRCSCNRSCHVHSGPSSPSVSLHNDIHTFRR
Download sequence
Identical sequences G3NGR1
ENSGACP00000004517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]