SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004715 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004715
Domain Number 1 Region: 302-418
Classification Level Classification E-value
Superfamily EF-hand 2.33e-30
Family Osteonectin 0.0076
Further Details:      
 
Domain Number 2 Region: 81-152
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.57e-18
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 3 Region: 38-82
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000541
Family Ovomucoid domain III-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004715   Gene: ENSGACG00000003595   Transcript: ENSGACT00000004729
Sequence length 422
Comment pep:known_by_projection group:BROADS1:groupVI:3448690:3465896:1 gene:ENSGACG00000003595 transcript:ENSGACT00000004729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVRMRVCPLLVFLCLLRDGRTQKFSALTFLRVDQDKECNMECSGAPRKPLCASDGRTFTS
RCEFLRAKCRDPQLEVIRGPCKDTSRCVAEKKYTEQQAKKLFPQVFVPVCNPDGTYSEVQ
CHSYTGYCWCVTPNGRPISGSAVANKKPRCQGSKQERATTREPGKAADETGLVVDPQPAG
DDEDIISQYPTLWEEQVRSRQNNRTRAPSSSCDEEQEDARRKNDAVFVPDCAQNGLLKVE
GCSACQGGCGTVWTSFHTIVTLLTGGSFVPCSLTYKYTYTYCHMNHNTCSHGLIQVFVVY
FPGCPGAKKTEFLTSVLDALSTDMVHAVTDPASTGKVAEPDPSHTLEERVVHWYFSQLDK
NSSGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDISNDKALSLQELMGCLGVTKEEGE
LN
Download sequence
Identical sequences G3NHA7
ENSGACP00000004715 ENSGACP00000004715 69293.ENSGACP00000004715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]