SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004823 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004823
Domain Number 1 Region: 171-322
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000675
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 354-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 323-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000129
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 53-165
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000659
Family Growth factor receptor domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000004823
Domain Number - Region: 400-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000802
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004823   Gene: ENSGACG00000003661   Transcript: ENSGACT00000004837
Sequence length 559
Comment pep:known_by_projection group:BROADS1:groupXIX:4639249:4649794:1 gene:ENSGACG00000003661 transcript:ENSGACT00000004837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATQAKNLPCDHDLSVGYQCSLVSRACCSDGAPEEPTTDAPKTELANDENTSNGDSQLRD
QCKGKCAHECVGNGTCTCFKGYKLKPDAKSCEDINECLLGASNCRGGERCINTQGSFRCQ
REVSCGTGYELTDDNNCKDIDECETDIHNCGPGLECQNTQGSFRCPPKVKCGSGFIQDAL
GNCIDINECISQTGPCHRGQICINTVGSYSCQRNSVNCGRGYHLNEEGTRCVDIDECKGP
EKVCAGHGCINLIGSYRCECEAGYVFNSITRLCEDINECRHYPGRLCAHKCDNILGSYKC
SCTTGFKLAADNRNCDDLNECESNPCSQECANVYGSYQCYCRRGYQLSDMDGMTCEDIDE
CALPTGGHICSYRCLNTPGSFHCSCPVSGYTVAPNGRSCQDVDECVAGTHTCTVNQSCFN
VQGGFRCLSFDCPNNYRHVGETRCERLLCNDSVECLAMPLRITYYHLTFPTNIPVFTNIF
RMGPTHTVAGDDIQIVITSGNEGGFFLTEQVPTGGVMSVAKLINKPQDFELSLELRLRRY
GTLSTYLAKVLVFVTQEEP
Download sequence
Identical sequences G3NHL4
ENSGACP00000004823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]