SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004829 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004829
Domain Number 1 Region: 278-429
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000573
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 461-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000044
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 422-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000171
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 4 Region: 169-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000311
Family EGF-type module 0.024
Further Details:      
 
Domain Number 5 Region: 200-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000411
Family EGF-type module 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000004829
Domain Number - Region: 511-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00051
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004829   Gene: ENSGACG00000003661   Transcript: ENSGACT00000004843
Sequence length 690
Comment pep:known_by_projection group:BROADS1:groupXIX:4639478:4661684:1 gene:ENSGACG00000003661 transcript:ENSGACT00000004843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLVQILPLCAGQISTEDCCKDGRKRGNDNQDCASLPLISESITCRIVQEQCCVTVLQDNM
CNTGINVAKDQGACDALFTNTCETKTTKMCCDCCLLGMATQAKNLPCDHDLSVGYQCSLV
SRACCSDGAPEEPTTDAPKTECGLANDENTSNGDSQLRDQCKGRIQYVTKGKCAHECVGN
GTCTCFKGYKLKPDAKSCEDINECLLGASNCRGGERCINTQGSFRCQREVSCGTGYELTD
DNNCKDIDECETDIHNCGPGLECQNTQGSFRCPPKVKCGSGFIQDALGNCIDINECISQT
GPCHRGQICINTVGSYSCQRNSVNCGRGYHLNEEGTRCVDIDECKGPEKVCAGHGCINLI
GSYRCECEAGYVFNSITRLCEDINECRHYPGRLCAHKCDNILGSYKCSCTTGFKLAADNR
NCDDLNECESNPCSQECANVYGSYQCYCRRGYQLSDMDGMTCEDIDECALPTGGHICSYR
CLNTPGSFHCSCPVSGYTVAPNGRSCQDVDECVAGTHTCTVNQSCFNVQGGFRCLSFDCP
NNYRHVGETVARLQRSDTIRCMKSCQPNDIACVLDPMHSVSHTFISLPTFREFTRPEEIV
FLRTTVPAYGSYHLGSYDVKFDILEGNVDDAFDVIKRVENGLFVGVVRQVKSVIGPLAAV
LKLSMRNLTTQGDSGQNIINVHVFVSEFWF
Download sequence
Identical sequences G3NHM0
ENSGACP00000004829 69293.ENSGACP00000004829 ENSGACP00000004829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]