SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004871 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004871
Domain Number 1 Region: 230-496
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.03e-78
Family Eukaryotic proteases 0.00016
Further Details:      
 
Domain Number 2 Region: 112-215
Classification Level Classification E-value
Superfamily Kringle-like 1.23e-28
Family Kringle modules 0.00027
Further Details:      
 
Domain Number 3 Region: 13-49
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family EGF-type module 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000004871
Domain Number - Region: 85-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.014
Family EGF-type module 0.0061
Further Details:      
 
Domain Number - Region: 52-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0142
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004871   Gene: ENSGACG00000003705   Transcript: ENSGACT00000004885
Sequence length 502
Comment pep:known_by_projection group:BROADS1:groupVI:3639819:3643603:-1 gene:ENSGACG00000003705 transcript:ENSGACT00000004885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSDWVFEMQEPEGQCNPNPCLNNGVCEEKGKRKFKCDCPKPFKGKKCQKGPKYCRKGRCG
RGECVLTSTPPFYECKCKEPFQPPHCTSEVSLCEPNPCKNGGQCIRDGNDFDCLCPTGHR
GRFCHVGPSDCYVDNGESYRGNVSETDDGHECLYWNSHFILESGADPFNSFEDSDGLGPH
NFCRNPDGDKMPWCFFRQGRRLSWDYCDVTKCLQPGQAPQPSLSPAEVTPSAAAPLQQFT
TCGQPQPKKNVARIFGGLKVPPGAAPWQVSLQVRPKSSNKPFSHTCGGTLIASCWVLTAG
HCILHSAGTKDMQVVVGALSTNIEEATAQTIQVEEAIVHENYRETPAAVYNDIALVRLKG
TGGVCANETQFVKTACLPDGQLPDGMECKISGWGATEDSPNGSAHLLDANVMLINQEKCS
EPKIYGTVLDNSMLCAGHLLGGVDSCQGDSGGPLICDQNNAKVVYGVVSWGDQCGKKNKP
GVYARVTRFLDWIKFKTQAASP
Download sequence
Identical sequences G3NHR1
ENSGACP00000004871 ENSGACP00000004871 69293.ENSGACP00000004871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]