SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005012 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005012
Domain Number 1 Region: 378-704
Classification Level Classification E-value
Superfamily DNase I-like 9.29e-53
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000713
Further Details:      
 
Domain Number 2 Region: 4-105
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-27
Family SH2 domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005012   Gene: ENSGACG00000003813   Transcript: ENSGACT00000005027
Sequence length 868
Comment pep:known_by_projection group:BROADS1:groupVIII:1936042:1944819:1 gene:ENSGACG00000003813 transcript:ENSGACT00000005027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIYQPWCHGTITRSQAEDLLSKAARDGSFLIRASESIKGAYALCVLFQNCVYTYRILPN
EDKKLSVQASEGVPIRFFSMLPELVEAYYSPNMGLITHLQYPVLREDEMDEEPESNNLPP
QLPPRNFLANDGKDSEPKSSEQSCKSLSDTYLMRLQHMDMSIIPEEHQTALQEYFRTSIS
LDAEQVQFGYPNLPGLKKLTMDICKNLNRESEISRILPVLEVFHRALDQQLSPGIGQTPK
QVGGSLDPLSAHTKLERLTKLLYCIEDKAKMSLFESVGNEGGHRKSLIPVVTFEVKQESL
AIPTKMFLKVDVESGKLFLKKSKDGPDDKFFVHNKILQLVKSQRMHAKLVIVAETEKEKI
LRKEFTFDDTKKREGFCQLLQQMKNKHSEKPEPDMITVFVGTWNMGNAGPPHNIDSWFQC
KGQGKTRDDTADHIPHDFYVIGTQEDPLGEREWAYTLKGVLRKITNISFKQVAIHTLWNI
RIVVLAKPEHENRISHVFSDSVKTGIANTLGNKGAVGVSFMFKGTSFGFVNSHLTSGSEK
KLRRNQNYTNILRFLNLGDKKLNPFDITHQFTHLFWLGDLNYRVEFPSTEAEYIVTKIKQ
QQYQELLSKDQLNMERNDGKVFLHFDEEEITFAPTYRFERDTRDKYAYTKAKATGTKYNL
PSWCDRVLRKSYPLVHVVCQAYGCTNDIMTSDHSPLFATFEVGVASQFVSKQDPNSAPQG
GIQIMNCVATLLTKSKTKFFIEYHSSCLEKTVKTLEGENTEHLDGSIKVWFGNQVELTPI
ISDPEYLLDQHILICVKSTDWDESYGEGCVALRAAQFAYTEFQITLTHHGERTGTLTGGI
QLRTSEGTPTEKLYDFIKVEKDDAVASK
Download sequence
Identical sequences G3NI52
ENSGACP00000005012 69293.ENSGACP00000005012 ENSGACP00000005012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]