SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005074 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005074
Domain Number 1 Region: 150-376,419-468
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.31e-48
Family Glycerol-3-phosphate transporter 0.038
Further Details:      
 
Domain Number 2 Region: 587-733
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.62e-19
Family Glycerol-3-phosphate transporter 0.047
Further Details:      
 
Domain Number 3 Region: 492-573
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000222
Family Pentapeptide repeats 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005074   Gene: ENSGACG00000003844   Transcript: ENSGACT00000005089
Sequence length 736
Comment pep:known_by_projection group:BROADS1:groupX:5292247:5299137:1 gene:ENSGACG00000003844 transcript:ENSGACT00000005089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGYQNRTAFIKGAKDIAKEVKRQASKKVGRSVDRVTDEYSKRSYSRFEEDDDDYPTQG
SQDGGYYRGDSQAANDDEGGHSDSTEGHDEDDEIYEGEYQGIPRAESGKGSLAGGPGSVR
AGAQEFSDTGVSEAERRKDQEELAQQYETILQECGHGKFQWTLYFVLGLALMADGVEIFV
VGFVLPSAEKDMCLSEPNKSMLGLIVYFGMMVGAFLWGALADRIGRRQSLLISLSINSIF
SFFSSFVQGYSTFLFCRLLSGVGIGGSIPIVFSYYSEFLSQEKRGEHLSWLCMFWMIGGI
YASAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVAAIAALSAMPESPRFYLENG
KHDEGWMILKQVHDTNMRAKGHPEKVFSVTTIKTVKQMDELTDIGTDTPMWQRYRMKIIS
LSQQIRNNILACFNPEYKRRTFMLMAVWFTMSFSYYGLTVWFPDMIKYIQKQEYDSRTKT
FTKERVEHVTFNFTLENQVHLEGHYFNDKFLNLKMKSMVFEDSVFEECYFEDITSIHTIF
RNCTFVASLFYNTDLFKYRFVNCKLLNSTFLHNKEGCMLDFSDDFNNAYMIYFVNFLGTL
AVLPGNIVSALLMDKIGRLRMLAGSSVISCVSCFFLMFGNSESGMIALLCLFGGISIASW
NALDVITVELYPSDKRTTAFGFLNALCKLAAVLGISIFQSFVGITKAVPIIFAAGALAAG
SFLATKLPETRGQVLQ
Download sequence
Identical sequences G3NIB4
ENSGACP00000005074 69293.ENSGACP00000005074 ENSGACP00000005074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]