SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005141 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005141
Domain Number 1 Region: 273-591
Classification Level Classification E-value
Superfamily DNase I-like 9.81e-39
Family DNase I-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005141   Gene: ENSGACG00000003914   Transcript: ENSGACT00000005156
Sequence length 592
Comment pep:known_by_projection group:BROADS1:groupXVII:1381921:1385626:1 gene:ENSGACG00000003914 transcript:ENSGACT00000005156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNRLPAALALLRPGRLLLASSPRSLTGARRPLGAMEPAAVRCLPGEPKLTISFRLDGSN
KHMLRDQDEALGKVLARITNGIAKSQKAKKSKKNSKGPPRQSPEPAAVKLYYEGQEVSDA
VPNSEAWRDGAVLQVGDVKYAIRRNAPTFTAAELPVSLLAEFPVCPNLEVEFGNLQDCEF
IWFRETSPNASPEAAGEPPRGDGGWTEVGRGRVHVPSNQDVGHRLKLLCIPKDGARAGST
EELVSAGAVEAGPGVCTFDNRHAYTAKEAEWPAVRVVTYNILADVYAQTELSKTVLYPYC
APYALQLDYRQNLIKKELAGYKADILCLQEVDKGVFSDCLTPALDAFGLDGVFRIKEKQH
EGLAMFYRRSKFQLLSRHDIVLREALTSDPIHSALLERVSANSALKGKILQRATVLQVSV
LEDLKKAGRKVCVANTHLYWHPKGGNVRLVQMGVALQHLSHVINEHAPGAPLVFCGDFNS
SPNSGVFQLLSETAIPLQHADWRSSGPEESISMELLSAFPPLLSACGQPAYTNYVGGFHG
CLDYIFIQPDSMQVEQVIPLPSHQEVTTYEALPSVAHPSDHIALICDLRWNP
Download sequence
Identical sequences G3NII1
ENSGACP00000005141 69293.ENSGACP00000005141 ENSGACP00000005141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]