SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005199 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005199
Domain Number 1 Region: 1529-1637
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-33
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 2 Region: 662-771
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-33
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 3 Region: 830-945
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 4 Region: 1880-1989
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 5 Region: 2219-2337
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-31
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 6 Region: 2052-2160
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-30
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 7 Region: 183-285
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-30
Family Spermadhesin, CUB domain 0.00089
Further Details:      
 
Domain Number 8 Region: 6-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.81e-30
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 9 Region: 2406-2509
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-28
Family Spermadhesin, CUB domain 0.00079
Further Details:      
 
Domain Number 10 Region: 1349-1465
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-28
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 11 Region: 490-601
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-27
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 12 Region: 1182-1291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 13 Region: 1703-1812
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-22
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 14 Region: 3113-3184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.16e-20
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 15 Region: 2997-3065
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.23e-19
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 16 Region: 3173-3242
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.05e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 17 Region: 2758-2826
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.35e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 18 Region: 2873-2946
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.29e-18
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 19 Region: 2815-2883
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.36e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 20 Region: 3054-3124
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 2929-2990
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 22 Region: 2510-2583
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000361
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 23 Region: 2699-2768
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000639
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 24 Region: 2165-2233
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000101
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 25 Region: 427-498
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 26 Region: 3293-3360
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 27 Region: 1469-1533
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000297
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 28 Region: 1642-1707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000054
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 29 Region: 1819-1883
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000702
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 30 Region: 2572-2639
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000715
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 31 Region: 1993-2055
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000114
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 32 Region: 951-1010
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000117
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 33 Region: 605-667
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 34 Region: 118-182
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000347
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 35 Region: 776-846
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000751
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 36 Region: 1295-1357
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000796
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 37 Region: 3225-3287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000132
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 38 Region: 1124-1186
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000148
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 39 Region: 2647-2710
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000135
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 40 Region: 3352-3410
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000195
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 41 Region: 1003-1125
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000089
Family Spermadhesin, CUB domain 0.008
Further Details:      
 
Domain Number 42 Region: 2336-2400
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000702
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005199   Gene: ENSGACG00000003938   Transcript: ENSGACT00000005214
Sequence length 3658
Comment pep:known_by_projection group:BROADS1:groupX:5549149:5742920:-1 gene:ENSGACG00000003938 transcript:ENSGACT00000005214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFIYTCGGTLKGRNGSIESPGFPYGYPNGANCTWVIVGEEGSRIQLMFLSFAIEEEYDFL
SLYDGHPHPANFRTRLTGFQVPTPVTSTGNVFSLRLTSDFAVSAHGFKLNYEELHSTSCG
NPGVPAKAVLSGGGRFAVGDHVRYSCVPGYVLDGHATLTCITNAGNTAVWDFPAPICRAE
DTCGGTVRGGSGVVTSPGYPGSYGNQADCTWILLAEPGDTISVIFTDFQTEEKYDYLEVE
GSEPPTIWLSGSNVPSPIVSNKNWLRLHFVSDANHRYRGYSAHYQGKMGLTAVTTAGFVE
QMDITPNGRFQVVSQPLALAVSQPSNILVCTLRNNVRLLSMDINRTGEPGRASKSGCHGV
PHSTNSVIRRQRHLGQEVRTRYIILFSSAVKRSVDFKSRGVKLFPGKDSSNKFSILNEGG
VKQASNSCPDPGEPENGKRHGSDFSIESVVQFSCGEDYVLQGSKTISCQRVAEVFAAWSD
HRPVCKVKTCGSNLQGPSGTFTSPNFPIQYESNAQCVWIITASNPNKVIQINFEEFDMEI
AYDTLTIGDGGEVGDPTAILQVLSGSFVPDLIVSMTHQMWLHLQSDESVGSIGFKINYKE
IDKESCGDPGTPLYGVREGDSFSNGGILRFECQFGFELIGERTISCQDNNQWSANIPICV
FPCMSNFTAPSGTVLSPDYPEGYGNNMNCVWLIQSDPGSRIHLAFNDFDLEAPYDSLTVK
DGETNDAGVIGRFSGAESPSHLTSNTNTLRLEFQADHSMSGRGFNITYSTFGHNECPDPG
IPINARRFGDSFQLGSSISVVCEDGFIKTQGTETISCQLEKGKVMWSGPIPKCEAPCGGH
FSAPNGVILSPGWPGYYKDSLSCEWVIESEPGRSIKITFDRFQTELGYDFLEIHDGPNLL
SPLVGSFNGTLVPQFLFSSTNFLYLLFTTDNSRSNAGFKILYESVTVDSYSCLDPGIPVN
GIRYGQDFSIGSTVSFGCDSGYRLSHEEPLVCEKNHWWSHPLPTCDALCGGDVRPERPSL
VSADPDTYPSFLTVPGRLKVKHRTRGVQFQFSSFHLEDQHDYLLVTENGSFQQPLARLTG
NELPSNINAGLYGNFKAQLRFISDFSISYEGFNITFSEYTLEPCEDPGMPRFGKRNGYNF
GIGDTLSFSCNMGYRLEGLPEVICLGGGRRMWSSPLPRCVAECGSSVMNNEGILLSPNYP
MNYDNNHECIYSIQVQAGKGINISARTFHLAQGDILKIYDGKDSTAHVLGAFTGSSMLGL
TLISTSNHLWLEFYSDAESTGEGFKLVYSSFELSHCEDPGVPQFGFKVNDQGHFSGSSIT
YRCEPGYTLHGASTLKCMTGERRAWDNPLPSCIAECGGRFKGESSGRILSPGYPFPYDNN
LRCTWTIEVDSGNIVSLQLLAFDTEASHDMLKIWDGPPENEMSLSELSGSLLPERIHSTL
NTVTVQFETDFYISKSGFAIQFSSSVATACRDPGVPMNGSRSGDGREPGDSVSFQCDPGY
ELQGDDKITCIQVDNRYYWQPSPPVCIAPCGGNLTESSGFILSPNYPHPYPHSKDCDWLI
AVNSDYVLSLAFIGFNIEPNYDFLYIYDGPDSNSPLIGSFQDSKLPERIESSSNTMHLAF
RSDGSVSYTGFHLEYKAKLRESCFDPGVVLNGTRLGSDYKLGSTVTFYCEAGYVLQGYST
LTCSMGDDGRPGWNRALPSCQAPCGSRSTGTEGTVLSPNFPRNYTSGQNCVYSISVPREF
VLFGQFVMFQTSLNDVVEIYDGPTQQNTLLSSLSGSHSGESLPLSTVNQITIKFTTVGPE
TAKGFHFVYQAVPRTSSTQCSSVPEPRFGKRLGNDFAVGSLVQFECNPGYVLHGSNAIRC
ESIPDNLAQWNDTLPTCMVPCGGVLSSRRGTILSPGYPEPYDNNQNCVWKVSVPEGAGIQ
IQVVSFATEHNWDSLDFYDGADNHAPRLGSYSGTTIPPLLNSTSNNLYLSFSSDISVSAA
GFHLEYTAIGLESCPEPQTPNYGIRQGDRFMVGDVVQFSCEQGYSLQGNAHITCMPGPVR
RWNYPVPLCLAQCGGSMTDVSGVILSPGFPGNYPSGLDCTWTVNLPVGFGIHLQFLNFST
EAIHDYLEIRSGTLEMGSVIDRFSGPVIPKPLFSTTHQTSFFFHSDYSQNKPGFHTTYQA
YQLQSCPDPRPFRNGIVIGTDFSVGMTVSFECLPGYSLIGEASLTCLHGISRNWNHPLPR
CEALCGGNITSLNGTIYSPGHPEEYPNFQDCVWSVRVPPGHGIYINFTVLSTEPVYDYIT
VWDGPDQSSPQIGQFSGNTALESVYSTSNIILIKFHSDFSGAGFFVLSYHAYQLRICQPP
PEVANADMLVEDGELEIGDIIRYRCHPGFSLVGSEILTCRLGERLQMDASPPTCQVQCPA
QDVRYDSSGVILSPGWPESYPNLQMCSWSVTVEKGYNVTITFESFHTEREFDVLEIFDGP
TANSPTLATLSGDLPAPFNLTTSGHQFLVRWSSDHGTNKKGFKIRYVALYCSTPDSPLHG
SISSQSGGHVNSVVRWACDRGYRLIGNATATCRRTALGYHAWDSPVPACQAVSCGAPKAP
TNGGVLTADYSVGTRVSYFCNDGYRLSSKELTSAICQPDGTWSNHNKIPRCSVVVCSSIG
SFSLEHGRWRIVNGSHYEYRTRIVFTCDPGYYRLGPAHIQCLPAGVWSWKNERPHCQVIS
CGELPSPPSGKKIGTQTTFGATAIFTCDAGFMLVGSAVRECLSSGLWSGMETRCLAGHCG
IPEGIVNGQVIGENFGYRDTVVYQCLPGFRLIGSSVRICLQDNQWSGQLPVCIPISCGHP
GSPIYGRTLGNGFNLNNVVSFVCNRGYEMEGPARAQCQANRQWSHPPPTCKVVNCSDPGI
PANSIRQSKIEHGNFTFGTVVFYDCNPGYYLFGSPVLTCQPTGQWDKPLPECIVVDCGHP
GSPPNGVLSGDKFTFGSTARYSCLGGRQLKGESSRTCQLNGMWSAPMPFCSGDTAGSCGD
PGVPSHGSREQTDFRIRSSVHFSCSEGYDLIGSSERMCFPNGTWSGTQPFCKPVQCGNPG
TPSNGRVFRLDGTTFSHSVIYSCMDGYLLSGATTRLCHANGTWSAAQPNCTMINCGDPGV
PANGLRYGEDFTIGQNVSFQCQPGYRMEEDGSPVRTCTHNGTWSGNMPMCTAVTCQPPPV
ISNGALQGSDFEWGSSVSYSCSPGYELSFPAVLTCVANGTWSGMLPQCLPKFCGDPGNPA
GGFREGRSFIYQSEVSFSCAPPLVLVGTATRLCENDGTWSGTHPRCIEPTKTSCDNPGTP
RYGSLNRTYGFKVGNVVSFQCQPGHLIQGSSSRTCQPDLTWTGAQPECIPHACKQPESPL
HVDVLGMDLPGFGYTLVYSCQQGFFLAGGSEHRVCKNDGTWTGKMPICRAGEKKKTTKPA
TGTPSPKLNDSIVPDDVFAPNYIWKGSYNYRGRKQPMTLGITSFNSTTGRVNVSLSNGNM
ELLLSGVYKASEARLSLLMYQVNYANQGNQLKDSAISPAKIIEDSWTMDGFVSAEPDGSS
YVFQGFIQGKDYGQFGLQRLGLNMSESQNSPPPQLGTNSSSVAIAILVPFFALIFTGFGF
YLYKQRTTPKTQYTGCSVHENNNGQAAFENPMYNTNAKAVEGKAVRFDPNLNTVCTMV
Download sequence
Identical sequences G3NIN9
ENSGACP00000005199 ENSGACP00000005199 69293.ENSGACP00000005199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]