SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005265 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005265
Domain Number 1 Region: 36-229
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.04e-43
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 2 Region: 488-591
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000392
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 435-476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000862
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 690-762
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000262
Family VWC domain 0.012
Further Details:      
 
Domain Number 5 Region: 269-334
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000293
Family VWC domain 0.016
Further Details:      
 
Domain Number 6 Region: 597-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000231
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000005265
Domain Number - Region: 334-399
Classification Level Classification E-value
Superfamily FnI-like domain 0.000314
Family VWC domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005265   Gene: ENSGACG00000004004   Transcript: ENSGACT00000005280
Sequence length 815
Comment pep:known_by_projection group:BROADS1:groupXIX:5400324:5458809:1 gene:ENSGACG00000004004 transcript:ENSGACT00000005280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKAGCDLFAFLAVFCASPAVVGFGVDPALRISPIDELTLGEGFDGVTQVQGFHSESRAFH
FQGSAREVTAPAEVSELMVQKLRGKSEFTVLATLKQDHLNSGVILSIHHSEHRFLELESS
GQRSEIRLHYRTKGQQPHTEVFPYSLADDQWHKVSVAVSASHVILHVDCNRIYERVVEAP
YMDVPEDASFWLGQRNTAHGFFKGVMQDVQILVMPQGYIAQCPDLNRTCPTCNDFHGLVQ
KIMELQDILAKTSSKLSRAEEKMNGLDGCYCERTCSVKGVVYREDEGWTDGCRNCTCTNG
TVQCEAVSCPPSQCLAGSAPAYVKGACCKECQPVCLFGGRELVDGDQRAVRDSSGRCLLF
ECTDSSMRRTAPGEPCPELNCSESEQITLNDRCCKVCRGHDFCSEGHGCAEHSDCVNLEA
GDCCVCKDGFRPLRDDNAYCEDIDECAEGKHYCRENTMCVNTPGSFMCICHTGYIRIDDY
SCTEHDECLTGLHDCDENALCFNMVGGHSCSCKPGYTGNGTVCKAMCDGLCQNGGTCVSP
NNCVCQQGFTGKRCETDIDECADGFVECDTKSTCVNLPGWYHCECRDGYHDNGLFSASGE
SCVDINECKTGRNTCANDTVCFNLDGGYDCRCPHGHNCTGDCIHNNKVKHSGQIWVLDSD
RCSVCSCQAGQVMCRRMVCDCDNPNADLFCCPECDPRLSSQCLHQNGLVTYGSGDTWVEN
CQQCQCLQGQVDCWPLPCPPVDCEFTVVPEGECCARCVTDPCQADTIRNDITKTCTDEHN
ISRFSGSSWIKHGTECTLCQCKNGHICCSVDPMCL
Download sequence
Identical sequences G3NIV5
69293.ENSGACP00000005265 ENSGACP00000005265 ENSGACP00000005265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]