SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005491 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005491
Domain Number 1 Region: 180-377
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.42e-60
Family Reprolysin-like 0.0000237
Further Details:      
 
Domain Number 2 Region: 397-471
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.22e-20
Family Blood coagulation inhibitor (disintegrin) 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000005491
Domain Number - Region: 604-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0686
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005491   Gene: ENSGACG00000004175   Transcript: ENSGACT00000005507
Sequence length 800
Comment pep:known_by_projection group:BROADS1:groupV:4822091:4829564:1 gene:ENSGACG00000004175 transcript:ENSGACT00000005507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSHVEKYEVVRPQRLQGRPQRSPQDPQLHPDAVQYELTVEGTKHTILLEKNRNLIGRGFT
ETRYSQDGKRMTTSPKEELCFYHGHIRGLEDSSVSVGICSGISGLLRLRQQVFLIEPLGR
AADGDHALFRREHLKLGGPFACGSSPNGTTRHNPDRDPGPRLSGLFRSRSWKTKAVAGPQ
KFVELFVVVDNAEYKRYGDQTKSRILEVINHVDKLYRPLNIRVVLVGLEIWTDGDHIDVD
VKSETTLDNFLLWRRADLLRRTDHDNAQFVTGKDFDGDTVGLANKFAMCTENSGGVNQDH
HDNPIGLASTIAHEMGHNFGLSHDAAGCLCGPSHSSGTCVMAEKLRTGSQAFPELFSGCS
VEQLADFMERARPGCLRPPGSARSVAAGPRCGDALLDPGEECDCGTVEECKNRCCDASTC
LLTGGSQCAHGQCCDNCQLKPAGSVCREKASECDLSEFCTGASSDCPEDAFQMDGKPCFD
QGEGFCHSGRCPTHQQHCWRLFGKGATVGPPECFGLNRRGENKTVQVLFYRNLLCGSMFC
GGGGESISGKMAVYKVYGIECKLAVDDDRTRSLDMVPRGTRCGGNKVCLDRQCVDASAYG
RPEECAKKCNNNGVCNHKKECHCDPGWAPPHCDIQYADLPQGHSGIIAGVCAAVSILLLI
SALTAGLLCCKKDDMDNYASKRKVHSAPDRPDRVFQEQGVSGRPQISPPTFMASTATQAC
APLMVSAPPRAAAPQVPTRRGSTGEPQKAPPPKPPKAPPPAPPPAQTKPVPPSKPLPPLS
KTRVSHLMSGPAPPLLPAEP
Download sequence
Identical sequences G3NJI0
69293.ENSGACP00000005491 ENSGACP00000005491 ENSGACP00000005491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]