SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005852 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005852
Domain Number 1 Region: 640-776
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 5.36e-37
Family XPF/Rad1/Mus81 nuclease 0.0004
Further Details:      
 
Domain Number 2 Region: 799-863
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000000000778
Family Hef domain-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005852   Gene: ENSGACG00000004432   Transcript: ENSGACT00000005869
Sequence length 879
Comment pep:known_by_projection group:BROADS1:groupV:5434099:5439326:1 gene:ENSGACG00000004432 transcript:ENSGACT00000005869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LADMAAPLLEFETEMFLSLFECDGLLVVAEGLGIDRILLQFMRVYSEQGSLVLLLNTTTP
EQEYFTEQLRVEGVTHLPRTVTSEVNSAERYNVYTEGGVLFVTSRILVVDFLTDRIPAHL
ISGILVYRAHKIIESFQEAFILRLYRQKNKTGFIKAFTDKATSFSSGFCQVERVMRNLFV
KKLYLWPRFQASVNTALDRHKPEVVELHVSLTPAMRAIQSSILDIMSACLKELKRYNPTL
EAEDLSVENTLGNAFEKTIRHYLDPLWHQLGAKTKALVQDLKVLRILLLYLTQYDCVTFL
NLLESLRSSQKNFGSNSGWLFLDSSTSMFMNARARVYRIPERVKRELVLENSPKWEALTE
VLQEMERENKSSQQEPGRVLICASDDRTCAQLQQYIRRGSDRMLNRLYVRTIGKRDSSAA
ASMDFESHKKGHGWPRNGAKGKEPAQKKKSTKSKNRPSLTLTQMMGKDEMDKAAGTGSSG
DEGDPMEDEEEQLQLDLSSDAYYGVLKEPLTVLHPLKGLTDPHSLTRVLHEVEPSFVVLY
DAEVGFVRQLEIYKASRPGKRLRVYFLIYGGSTEEQKYLTALSKEKKAFEHLIREKATMV
IPEEREGRGDTNLDLARHLEPANATTNTRKAGGQEQPQEPSRVIVDMREFRSELPSLLHR
RGLDIEPVTLEVGDYILAPDTCVERKSVSDLIGSLQSGRLYTQCLSMTRYYKKPVLLIEF
DPAKPFSLMARSDFRHEISSNDVSSKLTLLTLHFPRLRILWCPSPHATAELFLDLKQGRC
EPDAAAAQAVTAESDMVAESAELYNPGPYDFLLKMPGVNVKNYRAVVKNADNLADMCKLG
QDKLAEILGNANNGRLLYEFLHNVADVPAPVQKAKHTCL
Download sequence
Identical sequences G3NKI9
69293.ENSGACP00000005852 ENSGACP00000005852 ENSGACP00000005852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]