SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005936 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005936
Domain Number 1 Region: 600-905
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.34e-84
Family Protein kinases, catalytic subunit 0.000000000135
Further Details:      
 
Domain Number 2 Region: 10-184
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-76
Family Ephrin receptor ligand binding domain 0.0000000274
Further Details:      
 
Domain Number 3 Region: 312-515
Classification Level Classification E-value
Superfamily Fibronectin type III 2.68e-34
Family Fibronectin type III 0.0000505
Further Details:      
 
Domain Number 4 Region: 897-970
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.3e-21
Family SAM (sterile alpha motif) domain 0.0000747
Further Details:      
 
Domain Number 5 Region: 240-370
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000188
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005936   Gene: ENSGACG00000004496   Transcript: ENSGACT00000005953
Sequence length 972
Comment pep:known_by_projection group:BROADS1:groupXVII:2290295:2348895:-1 gene:ENSGACG00000004496 transcript:ENSGACT00000005953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLALPPPPTETLMDSTTATAELGWTVYPVSGWEEVSGYDENMNTIRTYQVCNVFDNNQNN
WVRTKYIRRRGAQRIHVEMKFSVRDCSSIPNVPGSCKETFNLYYYESDSDAATRTSPAWM
ENPWIKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRNGFYLAFQDYGGCMSLIAVR
VFYRKCPRIITNGALFQETLSGAESTSLVAARGVCIPNAEEVDVPIKLYCNGDGEWMVPI
GRCMCKAGNEAVENGTVCRACPSGFFKPTQKDEPCMQCPINSRTTSEGAINCVCRNGFYR
TDSDPLQMPCTTVPSAPQTVISSVNETSVMLEWLPPRDSGGREDVVFNIICKSCGGGRGG
CTRCGDNVQFLPRQLGLTEPRVISDLLAHTQYTFAVSMPNVCTDSSSSSLTTSLCLLPPP
AAPSTVSIMHQVSRTVDSIFSWSQPDQPNGVILDYELQYYQKDQSEYNGTAIRSQTNTVV
VRGLKPGSIYVFQVRARTVAGFGRYSGKLYFQTMTEEEYNTSIQEKLPLIIGSAAAGLVF
LIAVVVIVIVCNRRRGFDRTDSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFA
KEIDISCVKIEQVIGAGEFGEVCSGNLKLPGKREMFVAIKTLKSGYTEKQRRDFLSEASI
MGQFDHPNIIHLEGVVTKSSPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIASG
MKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWT
APEAIQYRKFTSASDVWSYGIVMWEVMSYGEKPYWDMTNQDVINAIEQDYRLPPPMDCPS
ALHQLMLDCWQKERNNRPKFSQIVNNLDKMIRNPSTLKATTPLSSGVHLPLLDRSIPDFS
SFSTVDEWLDAIKMGQYKDNFAGADYSTFDVVSQMTMEDILGVGVTLAGHQKKILNSVQM
MRAQMNQIQSVE
Download sequence
Identical sequences G3NKS3
ENSGACP00000005936 ENSGACP00000005936 69293.ENSGACP00000005936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]