SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006289 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006289
Domain Number 1 Region: 148-207
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000115
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 2 Region: 92-159
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000292
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 3 Region: 30-99
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000153
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006289   Gene: ENSGACG00000004768   Transcript: ENSGACT00000006306
Sequence length 252
Comment pep:known group:BROADS1:groupXVII:2682695:2686580:-1 gene:ENSGACG00000004768 transcript:ENSGACT00000006306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLLDTCARRRVASLLLLILLAVKAAAECSKPEAKENTVLTDQSLLLNTFSEGVEVYFE
CANGYVVESGSGKITCAQKNWSESDLICKKKDCGFPESRPNMLFDLSTGTLFGNVIRVFC
DKGFQLSGSSYKQCYATGWSGSAKCNIVSCDAPPEVLDGRISWDSQDEPKYGEVIEYVCK
QGFTLIGNSSIMCGEDGEYDSPAPSCEGVRTEERITTATASPTSTPPQEVSPSTESPASL
TDKTTSATRTVS
Download sequence
Identical sequences G3NLS6
ENSGACP00000006289 69293.ENSGACP00000006289 ENSGACP00000006289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]