SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006786 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006786
Domain Number 1 Region: 6-279
Classification Level Classification E-value
Superfamily DNase I-like 9.95e-53
Family Sphingomyelin phosphodiesterase-like 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000006786
Domain Number - Region: 331-386
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0772
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006786   Gene: ENSGACG00000005132   Transcript: ENSGACT00000006803
Sequence length 431
Comment pep:known_by_projection group:BROADS1:groupXVII:3340891:3345658:-1 gene:ENSGACG00000005132 transcript:ENSGACT00000006803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANTDSLRVRVFSLNCWGIRYVSKHTPQRYDMIGELLSKEEYDIVLLQEVWSEKDYLSLK
KKLAFCHPHSHHFKSGVIGSGLAIFSKHRIHDTFLYRYSLNGYPYMVQHGDWFGGKAVGM
AVLKLGGLTANVYVTHLHAEYSRDKDSYLPHRVVQAWELQQFVRHTSAAADVVILGGDLN
MHPQDLGSRLLMSYTGLRDSYLESAEFDGCEDGMTLIADNPFIGKGSMGPLEKGIRIDYI
LFKGSSERDVHCDFMSTTKGSAPDHPFPYSDHEALTAALRVETRQRPSKNQDSAGEGPRK
TAELVDIVTEARTEVKVGLHCAERMRYTAARTGAMGLALLFLELAIAAVPWLALGAAQPF
PRTSFYLLAALCVAILFTTALLYVFYSAELKSLQGAEDQMRLAVGSLQEELRGFPVAQPH
GAQRGALGPEE
Download sequence
Identical sequences G3NN72
69293.ENSGACP00000006786 ENSGACP00000006786 ENSGACP00000006786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]