SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006952 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006952
Domain Number 1 Region: 1410-1673
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-51
Family YWTD domain 0.00000291
Further Details:      
 
Domain Number 2 Region: 3172-3435
Classification Level Classification E-value
Superfamily YWTD domain 1.24e-48
Family YWTD domain 0.00000247
Further Details:      
 
Domain Number 3 Region: 367-630
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-45
Family YWTD domain 0.0000073
Further Details:      
 
Domain Number 4 Region: 2363-2619
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-44
Family YWTD domain 0.00000427
Further Details:      
 
Domain Number 5 Region: 4028-4298
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-44
Family YWTD domain 0.0000153
Further Details:      
 
Domain Number 6 Region: 1720-1977
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-41
Family YWTD domain 0.0000582
Further Details:      
 
Domain Number 7 Region: 705-942
Classification Level Classification E-value
Superfamily YWTD domain 1.02e-40
Family YWTD domain 0.0000247
Further Details:      
 
Domain Number 8 Region: 2038-2310
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-37
Family YWTD domain 0.0000267
Further Details:      
 
Domain Number 9 Region: 235-251,289-358,623-678
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.82e-17
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 10 Region: 1239-1280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000982
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 11 Region: 2706-2749
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000013
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 3117-3165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000167
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 13 Region: 1078-1117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 14 Region: 1037-1076
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000038
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 15 Region: 2830-2868
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 16 Region: 3599-3638
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000576
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 17 Region: 3042-3082
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000916
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 18 Region: 75-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 19 Region: 2876-2912
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 20 Region: 995-1033
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 21 Region: 189-229
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 22 Region: 1-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 23 Region: 2671-2709
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 24 Region: 2959-3001
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 25 Region: 155-191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 26 Region: 3557-3601
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 27 Region: 1120-1157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 28 Region: 3482-3517
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 29 Region: 2999-3041
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 30 Region: 3725-3765
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 31 Region: 3898-3935
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 32 Region: 1327-1370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000041
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 33 Region: 3768-3805
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 34 Region: 3690-3727
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 35 Region: 3520-3562
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 36 Region: 2316-2372,2617-2680
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000722
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 37 Region: 1158-1196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 38 Region: 2786-2832
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 39 Region: 3812-3848
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 40 Region: 1312-1402,1673-1716
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000439
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 41 Region: 38-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 42 Region: 119-152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000969
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 43 Region: 3084-3130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000112
Family EGF-type module 0.017
Further Details:      
 
Domain Number 44 Region: 1202-1239
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 45 Region: 1284-1320
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000038
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 46 Region: 3855-3892
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000537
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 47 Region: 2917-2959
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000746
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 48 Region: 1994-2040
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family EGF-type module 0.012
Further Details:      
 
Domain Number 49 Region: 3979-4011
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000219
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 50 Region: 2754-2790
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000314
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 51 Region: 3653-3686
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000615
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 52 Region: 4354-4386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000321
Family EGF-type module 0.015
Further Details:      
 
Domain Number 53 Region: 3941-3980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000075
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000006952
Domain Number - Region: 945-989
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000639
Family EGF-type module 0.0064
Further Details:      
 
Domain Number - Region: 4310-4335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00665
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 3439-3470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006952   Gene: ENSGACG00000005232   Transcript: ENSGACT00000006970
Sequence length 4632
Comment pep:known_by_projection group:BROADS1:groupXVI:10472750:10507372:1 gene:ENSGACG00000005232 transcript:ENSGACT00000006970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CELGQFRCATGRCIPGNWHCDGTSDCVDDSDEHDCPQVTCDHSHFECLSDGECIPVVWVC
DDEEDCEDGSDERHHCTGRTCTSGQFSCSNGACVPGEYWCDRLADCSDGSDERDCHYPEC
TQLRCANGACYNRTQKCDQILDCRDGSDEANCTQRCNTGLFACHNGLCIPQRYVCDHDDD
CGDRSDELNCTYPTCRGNYFTCPTGRCIHQIWVCDGEDDCEDNADEKGCDNVPRECYPGE
WPCPSSGLCIPIDQLCDGTAHCSEGEDESNTTVGRNCGYAGIWRCASLSCEHRCHASPDG
GTCSCPPGFIVSSNDSRSCIDFDDCSMWGVCDQLCEDRTGSHRCSCREGYTLEQHRHCRA
DVSTGVPSLLFSNGRDLLIGDIHGNSQRTLVPSQNRGIAVGVDFHYNLNRIFWTDTIQNK
VFSVDMDGSNMQVVLNVSVDYPENLAVDWVNNKLYVVETSVNRIDLVDFDGSNRVTLITE
NLGNPRGLALDPTVGYMFFSDWEALNGQPGLERAFMDGSNRYGIIGTKLGWPAGITLDIE
AKRIYWVDSRYDYIETATYDGLHRKTVVHGGAVIPHPFGISLFEHNVYFTDWTKMAVMKA
NKFTDSSPQVVYSTSQAPHGVAVIHQLKQPNVPNPCSVDTGGCEQICVLSHRSDNGGLGY
RCKCRMGYDLHADGKRCFAVRQFLLFSSQLAVRGIPFNLSSQEDIMLPVTGSPSYFVGVD
YSAEEDAIFFSDTAKDIIYKQKVDGTGREVLAANRVDGVEDLAYDWISQNLYWTDPRYRS
ISVMKLADKSRRAIVQNLNNPRAIVVHPPIGYIFWTDWYRPAKIMRAWGDGSHALSIVNT
TLGWPNGLAIDWSSMRLYWVDAFFDKIEHSNFDGRNRLSLGRITQISHPFGLTIFEGYAY
FTDWRLGGIVRVRKTDGGEMVIIRRGISHIMHVKSFDSNSQIGSNLCRRQTNPNGDCSHF
CFPAPDSQRVCGCPYGMKLLPNQQTCVEDSSNEPPTLQCGANSFSCGNSKCVPSSYRCDG
VDDCHDNSDEVDCGINNTTCSPSAFTCANKHCVPTGWRCDGQNDCFDNSDEHNCPTAIPG
TCPANQFTCANHRCIPQTWRCDTDNDCGDSSDEADCHLRGTCNPGQFQCPDHRCIDPNYV
CDGDRDCVDGADEQGCIYNCTGNEFKCSSGHQCINSYYRCDGVFDCSDRSDEQRCPTRPP
GMCHHESEFQCQSDGSCVPSTWECDGHPDCEDGSDEHHACPPRTCPSSLFRCDNGNCVLR
SWLCDGDNDCRDGSDERDCPTPPFRCPSMQWQCPGHSLCINLTTVCDNTPDCPNGADESP
LCNQESCSDNNAGCTHVCIQGPFGAQCSCPVGYQLSNDSKTCEDVDECFSPGLCSQHCFN
ERGSFRCHCQEGYALEANQRTCKVSDSRQAFLLVASRNQIVQDDITAQPNVVRSLVRDGR
NIVALDFDSATDRVYWSDTSQDRIWSANKNGSDRTVVFDSGVTVTESLAVDWVGRNLYWT
DYVLETIEVSKLQGTHRTVLVSENVTNPRGLVLDPRDGAHLMFWTDWGRNPRIERASMDG
KLRTVIINAKLYWPNGLTIDYPNNMLYFADAYLDFIDFCDYDGNNRKQVVASDLVLQHPH
AITIFEDFVYWTDRYINRVMRAHKWHGENQTVMLFNLPQPMGLVAVHPARQPAGENHCLR
SPCTHICLLSAVGPSYYSCACPSGWTLAVDQITCTRVEDPFLVVVRDSIIYGISLNPDEK
SNDAMVPIAGLHNGYDVDFDDNEQTLYWVEHPGEIHRVKSDGTNRTEFAPAAILGSPVGL
ALDWMTENLYYTNPATQSIEVLKLRGEAQYRKTLITNNGSPTGAGSPVGIAVDPARGKLY
WTDQGTESGIPAKVASADMDGLNPVTLFTNNLDHIEFITVDIQENKLYWAVTSTGMIERG
DTDGSNRITIVTGLSHPWGVAVHQNYLYFTDRNFEVIERVDKSTGANRVVLRDNVSGLRV
LKVHYRETSAGTSNGCTNNVGACEQLCLPRTQGLFTCACATGFKLNADNRTCAPYQSYVV
ISTLSAIKGFSLEGTDHSEAMVPVAGRGRNALHVDVHMASGFIYWCDFSSTVAAQNGVRR
IKPDGSGLHSVVTSGIGRNGIRGIAVDWAAGNLYFTNAFLTETYVEVLRLNTTFRRVLLK
TQVDMPRHIVVDPRNRYLFWADYGQNPKIERALLDGTNRTILVSSGIITPRGLALDWQTG
YVYWVDDSLDMIARVNPQGGETEIIRFGSRYPTPYGIAVFESSIIWVDRNLKKVFQASKQ
PGSAEPPAVIRDNVNMLRDVTVYDRRAQPTSSQELNHNPCTEVNGGCAHFCFAQPDGGNK
KCSCAFGNLGADGESCVVSRDDYLIYTTESTVRSLRLDPEDHALPFPVVNVPRTSVALDF
DLTDRRIYFTQSTAAGASKISYISLSSPTSDPIVVASDLGAPDGIAYDWINRRIYYSDYV
NQSISSMSVDGSQRTIIAHVSRPRAIMLDPCRGYMYWTDWGTHAKIERATLGGNFRTEIV
NSSLVWPNGLTLDYEEEKLYWADASLQKIERSSLTGSNREVIVSTAIYPFAMAMFGQFIY
WTDWNTRSIYRANKHDGSDQRVMIQNLPSRPMDVHVLASRKQQQCDSPCQQFNGGCSHIC
TPGPNGAECQCPSEGRWYLSENKHCIADNGTRCQPGQFTCMNGRCIRTQWKCDNDNDCGD
GSDESERVCAFHTCEPTVFTCGNGRCVPYHYRCDHYDNCGDGSDELGCLFRPCDPNTEFT
CSNGRCIAKDFVCNGVNNCYDNSTSDEQNCPERTCQPEHTKCQSTNICIPRSYLCDGDND
CGDMSDESPTHCATSTCSQTEFRCSSGRCIPAHWYCDGGADCADGSDEPLSCTTPVRTCT
TDQFRCDDGRCIASSWICDGDNDCGDMSDEDQRHECGNRTCSTAEFTCVNNQPPQRKCIP
RDWVCDGDADCADALDEHQNCSRRSCGINEFSCNNGLCIRNSYRCDRRNDCGDSSDEQSC
TYQPCQQHQFTCQNGRCVSHDFVCDGDNDCGDESDELEHTCHTPAPTCPPGEFRCDNGHC
VPLRQVCDRSDDCSDNSDEKGCGVNECTEPAVHHCDHNCTDTPTSFICTCRPGHRLMSDH
VTCDDIDECAETPSVCSQVCENTVGSYVCKCAPGFLREPDGHSCRQNSDISPYLIFSNRY
YLRNLSTDGQAYSLILQGLTSVVAMDFDRVDRRLYWIDVSRRVIERMSYTGANREVVVNG
VLHGEGLAVDWIARKLYWVDSFLDCLQVSELDGRFVKKLAEHCVDANNTFCFENPRAIVL
HPKYGFVYWTDWGDRAFIGRVGMDGTNKAAIITTKIEWPNGITIDYTNDKLYWSDAHLRY
IEYSDLDGHHRHTVYDGVLSHPFALTVFEDFVYWTDWNTRSVEKGNKYDGSGRQALVNTT
HRPFDIHVCHPYRQPIVNNPCAENNGGCSHLCLIRHAGRNHTCECPDHFLTVQIGGVTRC
LPMCSSTQYRCANNERCIPIWWKCDGQSDCRDGSDEPATCPARQCRLGQFQCNDGNCTSP
HFLCNSNQDCHDGSDEDPVLCATHQCEAHQWQCANKRCVPESWQCDGEDDCGDQSDEDPA
HCSARTCRPGQFKCRNGRCIPQSWKCDVDDDCGDNSDEPLEECMGREHRCDNHTEFDCKT
NYRCVPLWSVCNGNNDCRDNSDEQGCDEVTCDPNGDFRCDNHRCIPLRWSCDGDDDCGDN
SDERSCTPRSCTESEFRCGNLRCIPDRWVCDHDNDCEDNSDERDCELRTCPPGYFQCSSG
HCITERFKCDGNADCLDFTDETFCPTRFPNGTYCPAFLFECKNHVCVQPHWKCDGDNDCG
DNSDEELHLCLDIQCEAPFRFRCDNNRCIYSHELCNSVDDCGDGSDERQENCQSPTPGPC
SDDEYKCSNGQCIPLQYACDDYNDCGDQSDELGCHHGSSHMCSDNICEHNCTDLTQGGIL
CSCRHGFKPRMTEKHTCEDVNECEVYDTCPQECKNTKGSYECFCADGFLSFGEPRGTECA
AQGNPPVLLLPDNVRIRRFNLSSEQYSDYVDNAEHIQALDYLWDPEGQGLSVVYWTVLGR
GSQFGSIKRAHITTFNDNGNNPVKEVDLNLRYIASPDGIAVDWVGGHIYWTDSGTNRIEV
AKLDGRYRKWLIHTDLDQPAAIVVNPSLGRMYWTDWGRKPRIESAWMDGQHREVLVKEED
LGWPTGLALDYLNGNRIYWCDSKENIIESMKPDGTDRNTVISGDIGHPYSLDVFEGHVYW
TTKDKGEVWKTNKFGKGHKVKVLTINPWLTQVRIYQEQRHNQSVPNPCKTVCSHLCLLRP
GGYTCACPQGSSLVRFDSSECDAAIEAPVEMPAACRCMNGGTCYTDEGGLPKCKCPYGYV
GSYCEVGKSRGAPAGTAVAVLLAVIIILITGALAVGVFLNYKRTGSFIPPMPKLPNFSIL
VKSGDNGNGVTFRSGDNVDLGPPHIGVSFIDSAMQMDDHFAMEAGRQPITFENPLYATAP
GLSGDPAVIHPTQVPPLLTEFILPLGVTVNVSGEQLDNRFVNPAHHGGPDVAESKWSLFK
KKLKPSATFENPSYSEMKDEKAAGSRAVSSAPEPSPFVPPAKPQKTNRPSAFTPTEDSFK
DTANLVKADSDV
Download sequence
Identical sequences G3NNN8
ENSGACP00000006952 ENSGACP00000006952 69293.ENSGACP00000006952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]