SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007044 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007044
Domain Number 1 Region: 615-916
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-82
Family Protein kinases, catalytic subunit 0.00000000121
Further Details:      
 
Domain Number 2 Region: 27-198
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.42e-57
Family Ephrin receptor ligand binding domain 0.00002
Further Details:      
 
Domain Number 3 Region: 324-530
Classification Level Classification E-value
Superfamily Fibronectin type III 4.3e-24
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 4 Region: 905-977
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.34e-18
Family SAM (sterile alpha motif) domain 0.0011
Further Details:      
 
Domain Number 5 Region: 253-321,365-377
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000331
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007044   Gene: ENSGACG00000005322   Transcript: ENSGACT00000007062
Sequence length 985
Comment pep:known_by_projection group:BROADS1:groupXII:5828451:5848775:-1 gene:ENSGACG00000005322 transcript:ENSGACT00000007062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKSKRLQLVAQTHVLINGILITLQTKEEVLLDMKATGGELGWLTWPLEQGDKPGWEVTQR
TLNGSQFYTYSVCNVGEREQDNWLRTTFIQRHQSASRVFVELQFIVRDCNSFGGSSLTCK
ETFNLFTSESDADVGTTFRKGQFKKVATIAPDEITGKNELRINTETRVVENLSRKGFYLA
FQDIGACVALLSTRVYYKTCPATVKSLVLFPETVAGGENQGLREVSGACVDNAVSEESPR
IYCTVDGDWAVMVGQCQCKPGYEEVKEACQECRPGFFKAAASGDKCEPCPANSEQLDSGA
LVCPCTDGFYRAPTDPPTGPCSGLPSAPRDLVATTVQLSTGKLLLSWSPPEDTAGRTDVT
YSVECQRCEDSVCQLCGEKIRFEPAGTGLTDTKVSVSSLDAHLNYTFTVKAHSGVSMFEA
EPRSSRPPSSISLTVSLRYTDPPRITTLRMVERTSASLSLSWDVFPRPRSQSQPIQYKLT
YRKKDDNLVATTIIVRILEKNFVHVVDLTPCTAYMCKVQASLKKGLSLMSVFLPIPGPLT
QNNTAVIFAAAIGGAAMLFIVILVLFLRRRKRNSHSRQGPEDTYFSSSEQLKPLKTYVDP
HTYEDPNVAVLKFATEIHPSHITKQKVIGAGEFGEVYRGNLKMPGRKEVAVAIKTLKPGY
TEKQRQDFLSEASIMGQFSHQNIIRLEGVVTKFKHAMIVTEYMENGALDRYLKDHDGEFP
SFQLVGMMYGIAAGMKYLSDMSYVHRDLAARNILVNNNLECKVSDFGLSRVLEDDPEGTY
TTSGGKIPIRWTAPEAIAYRKFTSASDVWSFGIVMWEVMAFGERPYWDMSNHEVMKAINE
AFRLPAPMDCPSAVYQLMLQCWLQDRSKRPRFGDIVNLLDKLLRSPDSLKTIADFDPRVS
IRLPSTSGSDGSPFRSVSEWLESIKMSQYSENFTCAGVVTMDHVLQMKNEDIKNIGVRLP
GHLKRIAYSILGLKDQTSTLSVFAV
Download sequence
Identical sequences G3NNY0
ENSGACP00000007044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]