SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007053 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007053
Domain Number 1 Region: 1-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.23e-58
Family Ephrin receptor ligand binding domain 0.0000236
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000007053
Domain Number - Region: 197-230
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0717
Family Complement control module/SCR domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007053   Gene: ENSGACG00000005322   Transcript: ENSGACT00000007071
Sequence length 253
Comment pep:known_by_projection group:BROADS1:groupXII:5844754:5847785:-1 gene:ENSGACG00000005322 transcript:ENSGACT00000007071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLDMKATGGELGWLTWPLEQGDKPGWEVTQRTLNGSQFYTYSVCNVGEREQDNWLRTTF
IQRHQSASRVFVELQFIVRDCNSFGGSSLTCKETFNLFTSESDADVGTTFRKGQFKKVAT
IAPDEITGKNELRINTETRVVENLSRKGFYLAFQDIGACVALLSTRVYYKTCPATVKSLV
LFPETVAGGENQGLREVSGACVDNAVSEESPRIYCTVDGDWAVMVGQCQCKPGYEEVKEA
CQGCRGAEAGRRH
Download sequence
Identical sequences G3NNY9
ENSGACP00000007053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]